Welcome

We provide lists of spammers that persist in abusing forums and blogs with their scams, ripoffs, exploits and other annoyances*. We provide these lists so that you don't have to endure the never ending job of having to moderate, filter and delete their rubbish.

We provide a "free for use" site where you can check registrations and posts against our database. We list known forum and blog spammers, including IP and email addresses, usernames, how busy they are and, in some cases, evidence of their spam.

There are two ways that you can access this information, either by searching or by using the API provided to automate the searches. The API will allow your site (via a "mod" or plugin) to then make decisions about how you wish to handle the activities of spammers.

Please feel free to use our forum to discuss ways to detect and prevent spam.

Most Recent Submissions

Below are the most recent 200 submissions to our database.

Date IP Address Username Email Location Evidence
24-Oct-14 23:50172.245.2.137mireyauwxcymqtufriendlydad41wims@yahoo.comUnited States 
24-Oct-14 23:49178.137.0.147FrancisZokskadrlviv2@wegas.ruUkraine 
24-Oct-14 23:49222.77.201.199rqfgdhgrtqphenomenonhjozf@gmail.com
[ pheno.m.eno.nh.j.o.zf@gmail.com ]
ChinaEvidence
24-Oct-14 23:49140.237.6.138Mm2SZqrns1chshifaiuqlo@gmail.com
[ c.hsh.ifaiuql.o@gmail.com ]
ChinaEvidence
24-Oct-14 23:4927.159.204.160pacdffgsvdrfzneternaltnas@gmail.com
[ e.t.ern.a.l.tn.as@gmail.com ]
China 
24-Oct-14 23:49120.43.29.109pasyaerjffcontendergizp@gmail.com
[ co.n.t.end.ergizp@gmail.com ]
China 
24-Oct-14 23:4979.133.204.133BLigarrinahsxcfvb@outlook.comPoland 
24-Oct-14 23:49222.77.200.49WabkniNkgainchallmarkhpxk@gmail.com
[ h.a.ll.m.a.rkhpxk@gmail.com ]
China 
24-Oct-14 23:4936.250.176.99rzgiqkwpjvutuqugjudnktn3s@gmail.com
[ tuq.u.gjudnktn.3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:49193.201.224.48owfodcxupybgezsl5u1@hotmail.comUkraineEvidence
24-Oct-14 23:4937.57.200.173veltHogygeorebdizzyctxaxd@ymail.comUkraineEvidence
24-Oct-14 23:4936.250.176.99zhisousl30tuqugjudnktn3s@gmail.com
[ tu.q.u.g.jud.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:4936.250.176.99palrneywy3tuqugjudnktn3s@gmail.com
[ tuqu.gj.udnktn.3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:4946.164.235.197Holfdosseriesclunievov@gmail.comRussian FederationEvidence
24-Oct-14 23:49222.77.229.126Charlesdutwhitkvfff@hotmail.comChinaEvidence
24-Oct-14 23:495.138.25.54Aeronsopdanielbype@yandex.comRussian FederationEvidence
24-Oct-14 23:4946.161.41.153AScavovelostepeangalustyamnrikr@gmail.com
[ step.eangalustyamnrikr@gmail.com ]
Russian FederationEvidence
24-Oct-14 23:49195.211.154.168Douglaskivariationwya@gmail.comUkraineEvidence
24-Oct-14 23:4937.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
24-Oct-14 23:4936.250.176.99palmdunzv5tuqugjudnktn3s@gmail.com
[ tuq.u.g.j.ud.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:49188.240.131.184A41Mcornellcochran7081@discardmail.comRomania 
24-Oct-14 23:49125.95.30.162yjxbepmlhiug56@115mail.netChinaEvidence
24-Oct-14 23:49110.85.100.103rfdsggdhgpzxstoutehekex@gmail.com
[ s.t.ou.teh.e.k.ex@gmail.com ]
China 
24-Oct-14 23:49110.89.52.33IhRLOmbcrMretirementdwgma@gmail.com
[ r.et.ire.ment.d.wgm.a@gmail.com ]
ChinaEvidence
24-Oct-14 23:49110.89.52.140lnnvdebhooysagentrralpy@gmail.com
[ age.ntrr.a.l.p.y@gmail.com ]
China 
24-Oct-14 23:49220.200.4.231bqqfqnypadaniellyanr@hotmail.comChinaEvidence
24-Oct-14 23:4927.153.216.214Iec23d6n6tyo0dv38sw8no6kv@yeah.netChinaEvidence
24-Oct-14 23:49199.15.233.167Janicetqmbeyourselffor@gmail.comUnited States 
24-Oct-14 23:49125.95.30.162hwuziehrobhw44@115mail.netChinaEvidence
24-Oct-14 23:4927.153.164.81ljdwefdsyrozuyfeatureuhhv@gmail.com
[ f.e.at.u.re.uhh.v@gmail.com ]
China 
24-Oct-14 23:49134.249.48.26Autuqasrautuqa93@gmail.comUkraineEvidence
24-Oct-14 23:495.138.25.54Akaronfumanaronhix@yandex.comRussian FederationEvidence
24-Oct-14 23:4946.118.112.28CynziaKtcynzia92@gmail.comUkraineEvidence
24-Oct-14 23:4958.22.135.94bqqfqnypadaniellyanr@hotmail.comChinaEvidence
24-Oct-14 23:48120.33.216.151pndoarqjqrandomtixuyg@gmail.com
[ r.a.nd.om.ti.x.uy.g@gmail.com ]
ChinaEvidence
24-Oct-14 23:48120.33.216.151pndoarblvrandomtixuyg@gmail.com
[ ra.n.do.m.t.i.x.u.y.g@gmail.com ]
ChinaEvidence
24-Oct-14 23:4836.250.176.99ooulziwjq7tuqugjudnktn3s@gmail.com
[ tu.qug.j.u.d.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:48178.137.0.147FrancisZokskadrlviv2@wegas.ruUkraine 
24-Oct-14 23:4836.250.176.99baunzezf2tuqugjudnktn3s@gmail.com
[ tuqug.jud.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:4836.250.176.99ludqzqxd91tuqugjudnktn3s@gmail.com
[ t.uq.ugj.u.dn.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:4891.200.12.53FcCJXxpmuUdrainagelikvad@gmail.com
[ d.r.a.inag.eli.kva.d@gmail.com ]
UkraineEvidence
24-Oct-14 23:48222.77.205.116yurt6uyhh1ughjgfrsy@163.comChinaEvidence
24-Oct-14 23:4836.250.176.99evwsxcvhl7tuqugjudnktn3s@gmail.com
[ t.u.qug.j.u.dn.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:48110.82.156.223pasyaeraxoreleasevdqr@gmail.com
[ r.e.lea.se.v.dqr@gmail.com ]
China 
24-Oct-14 23:4827.159.255.217ljdedseyrociglongtermuaklbw@gmail.com
[ longt.erm.ua.k.lbw@gmail.com ]
ChinaEvidence
24-Oct-14 23:48199.15.233.173Evangelintowbeyourselffor@gmail.comUnited States 
24-Oct-14 23:4827.159.252.42ffcxsdhdkkyhypothesisylrsnq@gmail.com
[ hy.po.thes.isy.lr.sn.q@gmail.com ]
ChinaEvidence
24-Oct-14 23:48155.133.19.216ubistesnimihmarcelledanielmada@gmail.com
[ ma.rcell.ed.an.ie.lm.a.d.a@gmail.com ]
GermanyEvidence
24-Oct-14 23:48221.176.14.83pasyaerrjqcampaigncomp@gmail.com
[ ca.mp.ai.gnco.mp@gmail.com ]
China 
24-Oct-14 23:4827.159.252.27yiyhngdjyzuldebtorkotets@gmail.com
[ de.bt.or.k.ote.ts@gmail.com ]
ChinaEvidence
24-Oct-14 23:4827.153.228.111kjjbghgrlicportioniluoig@gmail.com
[ p.o.r.t.i.on.iluo.i.g@gmail.com ]
ChinaEvidence
24-Oct-14 23:48110.89.34.232sdf0d806090fanaticsxyer@gmail.com
[ fa.n.a.t.ics.xye.r@gmail.com ]
ChinaEvidence
24-Oct-14 23:48175.44.4.129nhdac64m85wingls993lgnzongbuyes@gmail.com
[ wi.n.gls99.3lgn.z.ongbuyes@gmail.com ]
ChinaEvidence
24-Oct-14 23:4827.150.239.201pasyaerxxkcampaigncomp@gmail.com
[ c.ampa.i.g.n.c.omp@gmail.com ]
China 
24-Oct-14 23:48222.77.229.126Charlesdutwhitkvfff@hotmail.comChinaEvidence
24-Oct-14 23:4862.210.113.17WPphonickn@outlook.comFrance 
24-Oct-14 23:4827.159.212.134rfxcvcgdhgqtxneptunefgfuki@gmail.com
[ n.e.p.t.u.ne.f.g.f.u.ki@gmail.com ]
China 
24-Oct-14 23:4827.150.239.201pasyaerrjqcampaigncomp@gmail.com
[ ca.mp.ai.gnco.mp@gmail.com ]
China 
24-Oct-14 23:48120.43.29.109pasyaerelccontendergizp@gmail.com
[ c.on.t.en.de.rgi.z.p@gmail.com ]
China 
24-Oct-14 23:4862.210.113.18KXBDSharlorwlpgo@yahoo.comFrance 
24-Oct-14 23:48110.82.132.164nfl jersey 4 allzvfdbdf@gmail.comChina 
24-Oct-14 23:4831.132.4.149Junio8232aimeerobertson456@gmail.com
[ aimee.robertson456@gmail.com ]
United Kingdom 
24-Oct-14 23:48199.15.233.140RodneyPrgsdafjeoewafs@mail.ruUnited States 
24-Oct-14 23:4831.132.4.149Sherl03Saimeerobertson456@gmail.com
[ aimee.robertson456@gmail.com ]
United Kingdom 
24-Oct-14 23:4837.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
24-Oct-14 23:48110.89.52.33HpABJmaswSretirementdwgma@gmail.com
[ re.tir.e.ment.dwgma@gmail.com ]
ChinaEvidence
24-Oct-14 23:4837.57.231.125AbizyaloTowkisorjeronimo@gmail.comUkraineEvidence
24-Oct-14 23:48120.37.227.152vf1r6xqa3x72yujyujrthb@126.comChinaEvidence
24-Oct-14 23:48120.43.31.47pasyaerburappointjmxwno@gmail.com
[ appo.i.nt.jmx.wno@gmail.com ]
China 
24-Oct-14 23:48222.77.227.58v78a86jgbirthrightvqcb@gmail.com
[ bir.th.r.igh.tvqcb@gmail.com ]
ChinaEvidence
24-Oct-14 23:48178.45.35.137AshBrielsleonid340i@gmail.comRussian FederationEvidence
24-Oct-14 23:4827.150.231.60speqy21119jokeraa54107338@gmail.com
[ j.o.ke.raa.5.4.1.0.73.3.8@gmail.com ]
ChinaEvidence
24-Oct-14 23:48120.37.227.152zs5s6mvfgzwortyhgyjyj@126.comChinaEvidence
24-Oct-14 23:48195.211.155.143WqKNGksirXunfairgsbzb@gmail.com
[ un.fairg.s.b.z.b@gmail.com ]
Ukraine 
24-Oct-14 23:48110.85.100.214odvxqxtoemotelike@hotmail.comChina 
24-Oct-14 23:48222.77.201.199rqfgdhgghgphenomenonhjozf@gmail.com
[ phenom.eno.nh.j.o.zf@gmail.com ]
China 
24-Oct-14 23:4836.250.176.99palbtgsxu1tuqugjudnktn3s@gmail.com
[ tuq.u.g.ju.dn.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:4862.210.97.80GTyekeveths@yahoo.com.hkFrance 
24-Oct-14 23:4827.159.205.198rqfgdhgiatskepticalzighul@gmail.com
[ sk.epti.calzi.gh.u.l@gmail.com ]
China 
24-Oct-14 23:4836.250.176.99asjidfta78tuqugjudnktn3s@gmail.com
[ t.u.qugj.udnktn.3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:48125.78.241.8wrlnyteztnausokey@newzbling.comChinaEvidence
24-Oct-14 23:4837.57.200.173crangecycleabobbylitle@cmail.comUkraineEvidence
24-Oct-14 23:4836.250.176.99qsmmltrfd9tuqugjudnktn3s@gmail.com
[ tu.q.u.g.ju.dn.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:4836.250.176.99bhfcunkwergtuqugjudnktn3s@gmail.com
[ t.uqug.jud.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:48195.211.155.143LxVKUellnYunfairgsbzb@gmail.com
[ u.nf.a.i.rg.s.bz.b@gmail.com ]
Ukraine 
24-Oct-14 23:47125.95.30.162bdgzxvjaprhb12@115mail.netChinaEvidence
24-Oct-14 23:47193.201.224.81WilliamWatyourmail@gmail.comUkraine 
24-Oct-14 23:47193.201.224.126ReahUtetuagmaddaavviidd123nk@gmail.comUkraine 
24-Oct-14 23:47120.37.234.166pacdffgsvdrgjaopponentdfiw@gmail.com
[ o.pp.on.en.td.fiw@gmail.com ]
China 
24-Oct-14 23:4727.159.205.198rfxcvcgdhgnmyskepticalzighul@gmail.com
[ s.k.eptic.al.z.ig.h.ul@gmail.com ]
ChinaEvidence
24-Oct-14 23:47110.82.156.223ljdedseyroerkreleasevdqr@gmail.com
[ release.vdqr@gmail.com ]
ChinaEvidence
24-Oct-14 23:4791.200.12.53TmYEArmdrBdrainagelikvad@gmail.com
[ d.ra.in.a.gelik.vad@gmail.com ]
UkraineEvidence
24-Oct-14 23:4794.23.251.168abubujizevetaixozeseko@gmaieredd.comFranceEvidence
24-Oct-14 23:4746.118.113.196ocakjehjapeqisuu@hotermail.orgUkraineEvidence
24-Oct-14 23:4727.153.228.111liogfchhrzsportioniluoig@gmail.com
[ po.r.tio.n.i.l.u.oig@gmail.com ]
China 
24-Oct-14 23:47178.137.0.147FrancisZokskadrlviv2@wegas.ruUkraine 
24-Oct-14 23:4727.159.252.27lhggjfdoepodebtorkotets@gmail.com
[ d.e.b.t.o.r.kot.e.ts@gmail.com ]
China 
24-Oct-14 23:47120.43.31.47ljdedseyroppiappointjmxwno@gmail.com
[ a.ppoi.ntjmxw.n.o@gmail.com ]
ChinaEvidence
24-Oct-14 23:4737.57.200.173veltHogygeorebdizzyctxaxd@ymail.comUkraineEvidence
24-Oct-14 23:47125.95.30.162yjxbepmlhiug56@115mail.netChinaEvidence
24-Oct-14 23:47110.89.52.140lnnvdebhooysagentrralpy@gmail.com
[ age.ntrr.a.l.p.y@gmail.com ]
China 
24-Oct-14 23:47110.86.186.139vzjl1p413mvjokeraa54107338@gmail.com
[ j.o.ke.raa5410733.8@gmail.com ]
ChinaEvidence
24-Oct-14 23:47222.77.228.246tpqi5531surviveepil@gmail.com
[ s.urvi.v.eep.il@gmail.com ]
ChinaEvidence
24-Oct-14 23:475.138.25.54Anaronfumgtwilliam@yandex.comRussian FederationEvidence
24-Oct-14 23:4727.153.209.228xoje5110sedimentvrpt@gmail.com
[ s.ediment.v.rpt@gmail.com ]
ChinaEvidence
24-Oct-14 23:4737.49.137.243ZSdunouguaixian81@163.comDenmark 
24-Oct-14 23:4737.48.80.173EFjaniawebbilyqkl@yahoo.comNetherlands 
24-Oct-14 23:47110.85.103.120pacdffgsvdrscaeerilympkf@gmail.com
[ eer.i.ly.m.pkf@gmail.com ]
China 
24-Oct-14 23:4780.72.35.84ZMWTrinalesli66@alec.co.plPoland 
24-Oct-14 23:4727.153.164.81ljdwefdsyrozuyfeatureuhhv@gmail.com
[ f.e.at.u.re.uhh.v@gmail.com ]
China 
24-Oct-14 23:4737.59.194.250celestaaronsontpmechristinaoliverio44@gmail.com
[ c.h.r.istina.oliverio44@gmail.com ]
France 
24-Oct-14 23:4727.159.197.211gooiencpslburenkao220@gmail.com
[ b.ur.en.kao.22.0@gmail.com ]
ChinaEvidence
24-Oct-14 23:4761.154.16.175bqqfqnypadaniellyanr@hotmail.comChinaEvidence
24-Oct-14 23:47134.249.48.26Autuqasrautuqa93@gmail.comUkraineEvidence
24-Oct-14 23:47109.255.112.66T1545jessfarthing25@gmx.comIrelandEvidence
24-Oct-14 23:47223.86.102.222NBignolddeanalldrew51@gmail.com
[ d.e.a.na.lld.rew51@gmail.com ]
China 
24-Oct-14 23:47121.205.199.5nike shox turbo tlxkijuyh675dsa@gmail.comChina 
24-Oct-14 23:475.255.73.82dyandhegqzfbnhcrpbucevyqyq@yahoo.comNetherlands 
24-Oct-14 23:4736.250.176.99nsxnfwboxkituqugjudnktn3s@gmail.com
[ tuq.ug.j.u.d.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:4727.159.194.65ltdfdrfdomtysegmentvvmihv@gmail.com
[ se.g.m.en.t.vv.mi.h.v@gmail.com ]
China 
24-Oct-14 23:4714.110.176.215Mamkapsokeitj@newsinhouse.comChinaEvidence
24-Oct-14 23:4736.250.176.99asjiujyn95tuqugjudnktn3s@gmail.com
[ t.uqugjudnktn.3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:4737.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
24-Oct-14 23:47120.33.216.151ljseyrouirrandomtixuyg@gmail.com
[ ra.n.do.m.t.ix.uy.g@gmail.com ]
ChinaEvidence
24-Oct-14 23:4727.159.205.198rqfgdhgtknskepticalzighul@gmail.com
[ s.ke.ptic.alzi.ghul@gmail.com ]
ChinaEvidence
24-Oct-14 23:4762.210.38.5JMayhewplarmettvn@yahoo.com.hkFrance 
24-Oct-14 23:4727.153.228.111kjjbghgrjpiportioniluoig@gmail.com
[ po.rti.o.n.ilu.oi.g@gmail.com ]
ChinaEvidence
24-Oct-14 23:4727.159.204.39pasyaergfhcomedyolwh@gmail.com
[ c.om.ed.y.o.lw.h@gmail.com ]
ChinaEvidence
24-Oct-14 23:4727.150.239.201pasyaerwuzcampaigncomp@gmail.com
[ campa.ig.nco.m.p@gmail.com ]
ChinaEvidence
24-Oct-14 23:47222.77.206.1690b5x64vjuwrtyhdfhb8@gmail.com
[ r.tyh.d.f.h.b8@gmail.com ]
ChinaEvidence
24-Oct-14 23:4769.12.72.252OSmonsterour@yahoo.comUnited States 
24-Oct-14 23:475.255.88.144trevor3593bjivwekhynigugi@yahoo.comNetherlands 
24-Oct-14 23:47176.31.122.130epacukuxababmeu@erermail.comFranceEvidence
24-Oct-14 23:47175.44.4.129nysfu8826pwingls993lgnzongbuyes@gmail.com
[ w.in.gls99.3lgn.z.ongbuyes@gmail.com ]
ChinaEvidence
24-Oct-14 23:47104.151.230.82HUdjeboniufct@hotmail.comEvidence
24-Oct-14 23:4714.110.176.215foemojikjaisybid@blogshoponline.comChinaEvidence
24-Oct-14 23:4727.159.255.55pasyaerdesdawningrobhcq@gmail.com
[ da.wnin.gr.ob.h.cq@gmail.com ]
ChinaEvidence
24-Oct-14 23:4727.159.196.201pacdffgsvdryxfindenturerknr@gmail.com
[ inde.n.t.ur.erk.nr@gmail.com ]
ChinaEvidence
24-Oct-14 23:46186.91.41.66apitycahvs8606seo6kaei@gmail.comVenezuela 
24-Oct-14 23:46120.37.230.2nike free wafflemeinb@gmail.comChina 
24-Oct-14 23:4627.159.194.65ltdfdrfdoqtjsegmentvvmihv@gmail.com
[ s.e.gm.e.n.tvv.mihv@gmail.com ]
ChinaEvidence
24-Oct-14 23:46117.169.1.98ATaubmanartistrypykzy@gmail.com
[ arti.s.t.ry.pykz.y@gmail.com ]
China 
24-Oct-14 23:46110.85.100.103fdsgdhdufnstoutehekex@gmail.com
[ st.o.ut.e.he.k.ex@gmail.com ]
ChinaEvidence
24-Oct-14 23:4646.118.112.28CynziaKtcynzia92@gmail.comUkraineEvidence
24-Oct-14 23:46151.236.24.15Marcuspefmichaelml2014@yandex.comIceland 
24-Oct-14 23:46120.37.234.166ljdwefdsyroqktopponentdfiw@gmail.com
[ op.po.n.e.nt.d.fi.w@gmail.com ]
ChinaEvidence
24-Oct-14 23:4677.121.142.102kurmadomhurisbod21@yandex.ruUkraine 
24-Oct-14 23:46120.37.206.71衣包helobarrelfulylocju@gmail.com
[ b.a.rrelfulylocju@gmail.com ]
China 
24-Oct-14 23:4627.159.211.88pacdffgsvdragucanaryjyehdh@gmail.com
[ c.a.n.a.ry.j.y.e.h.dh@gmail.com ]
ChinaEvidence
24-Oct-14 23:4662.210.38.5HLplarmettvn@yahoo.com.hkFranceEvidence
24-Oct-14 23:4627.153.228.111liogfchhfkxportioniluoig@gmail.com
[ po.rt.ion.il.uo.ig@gmail.com ]
ChinaEvidence
24-Oct-14 23:46120.33.196.50Vivienne Westwood Salebkwimi@gmail.comChina 
24-Oct-14 23:46117.26.196.77ns69xmd802ln8gl62u8i4fn4@126.comChinaEvidence
24-Oct-14 23:46191.101.52.187RSrocco_hickman2335@yahoo.comEvidence
24-Oct-14 23:46212.83.189.36WQjorgnorfleet@trash-mail.comFranceEvidence
24-Oct-14 23:465.157.41.172bobbyewestacotttybaduny@yahoo.comLuxembourg 
24-Oct-14 23:46110.89.26.30rqfgdhghqagallopkvyarx@gmail.com
[ g.allop.kv.y.arx@gmail.com ]
China 
24-Oct-14 23:46117.26.196.77o1c7t6asaxms6l995j141qx8@126.comChinaEvidence
24-Oct-14 23:46113.245.96.97aj5hxthrtianyi23456@hotmail.comChina 
24-Oct-14 23:46117.26.196.77accse824j2il4rs77r9c1kv4@126.comChinaEvidence
24-Oct-14 23:46178.137.0.147FrancisZokskadrlviv2@wegas.ruUkraine 
24-Oct-14 23:4627.159.255.55pasyaerkxkdawningrobhcq@gmail.com
[ daw.n.i.n.g.rob.h.c.q@gmail.com ]
China 
24-Oct-14 23:46173.208.74.10Rashad77Bmyellatoyiadisnbmd@outlook.comUnited States 
24-Oct-14 23:46120.37.208.80lo7b5ocdxs3aerytyujuyi@126.comChinaEvidence
24-Oct-14 23:46204.44.90.244angusricardoyfqlwowebuyer@yahoo.comUnited States 
24-Oct-14 23:465.39.32.106wernerspeightycdchiqijopoloke@yahoo.comFrance 
24-Oct-14 23:4627.153.209.228xoje5110sedimentvrpt@gmail.com
[ s.ediment.v.rpt@gmail.com ]
ChinaEvidence
24-Oct-14 23:46183.207.228.12bannetaepita6781indicatorcegg@gmail.com
[ i.n.d.i.c.a.t.o.rcegg@gmail.com ]
China 
24-Oct-14 23:46222.77.228.246tpqi5531surviveepil@gmail.com
[ s.urvi.v.eep.il@gmail.com ]
ChinaEvidence
24-Oct-14 23:4661.155.169.11bobertosjnra9396seo6kaei@gmail.comChina 
24-Oct-14 23:46192.74.236.243buhuperpoindicatorcegg@gmail.com
[ i.nd.icat.o.rcegg@gmail.com ]
United StatesEvidence
24-Oct-14 23:4627.159.198.95pacdffgsvdruskmarketingpgjn@gmail.com
[ m.a.rket.ingpg.jn@gmail.com ]
China 
24-Oct-14 23:4662.205.84.44Gregorygregone-1986@hotmail.comBelgium 
24-Oct-14 23:4636.250.89.95bdizzycusasd339indicatorcegg@gmail.com
[ in.dic.ator.cegg@gmail.com ]
China 
24-Oct-14 23:46222.77.227.58v78a86jgbirthrightvqcb@gmail.com
[ bir.th.r.igh.tvqcb@gmail.com ]
ChinaEvidence
24-Oct-14 23:4691.213.72.176stephaniax40jysdecampsa@yahoo.comKazakhstan 
24-Oct-14 23:465.164.153.116AshBrielsleonid340i@gmail.comRussian FederationEvidence
24-Oct-14 23:46195.211.154.168Douglaskivariationwya@gmail.comUkraineEvidence
24-Oct-14 23:4636.250.176.99palgtigft6tuqugjudnktn3s@gmail.com
[ t.uqu.g.j.u.dn.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:4636.250.176.99asjicsob53tuqugjudnktn3s@gmail.com
[ t.u.qug.j.u.d.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:4627.159.252.42rqfgdhghqehypothesisylrsnq@gmail.com
[ hy.poth.es.i.s.y.lr.sn.q@gmail.com ]
China 
24-Oct-14 23:46110.89.34.36gfurt6y8v1gfjdfyrdtyh@126.comChinaEvidence
24-Oct-14 23:46120.43.23.189ljdedseyromyxtabulaterzom@gmail.com
[ tabu.l.ate.rzom@gmail.com ]
China 
24-Oct-14 23:4646.118.113.196iadriruexteibecilgio@hotermail.orgUkraineEvidence
24-Oct-14 23:4627.159.235.64B82zd790z0jj2vp7bb8y2d5h@126.comChinaEvidence
24-Oct-14 23:4636.250.176.99dwycpnal99tuqugjudnktn3s@gmail.com
[ tuq.ugj.u.dn.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:46110.85.115.32so5914103producesnxa@gmail.com
[ prod.uce.sn.xa@gmail.com ]
ChinaEvidence
24-Oct-14 23:4627.159.194.65ltdfdrfdoeersegmentvvmihv@gmail.com
[ se.gm.ent.vvm.ih.v@gmail.com ]
ChinaEvidence
24-Oct-14 23:46116.228.55.217RafaelPatoreelectionryudx@gmail.comChina 
24-Oct-14 23:4691.207.7.194cuuhogdrmzitdwrh1ra@hotmail.comUkraineEvidence
24-Oct-14 23:4627.159.210.210pacdffgsvdrcwsinstructqfho@gmail.com
[ i.ns.t.r.uc.t.q.fh.o@gmail.com ]
ChinaEvidence
24-Oct-14 23:46188.165.196.77iqujuebewusaqigel@ssteermail.comFranceEvidence
24-Oct-14 23:46211.162.34.56bqqfqnypadaniellyanr@hotmail.comChinaEvidence
24-Oct-14 23:4637.236.167.250adamashtolze8809indicatorcegg@gmail.com
[ i.ndi.cat.o.rcegg@gmail.com ]
Iraq 
24-Oct-14 23:4637.57.231.125AbizyaloTowkisorjeronimo@gmail.comUkraineEvidence
24-Oct-14 23:46117.26.254.182pacdffgsvdruforescueuilc@gmail.com
[ r.e.scue.u.ilc@gmail.com ]
ChinaEvidence
24-Oct-14 23:4627.153.208.38RafaelPatoreelectionryudx@gmail.comChina 
24-Oct-14 23:4627.159.211.88pacdffgsvdrummcanaryjyehdh@gmail.com
[ c.a.nary.jy.e.hd.h@gmail.com ]
China 
24-Oct-14 23:4627.159.195.234fdddevfrmqvmodestlyfettlk@gmail.com
[ mo.d.e.s.t.l.yf.e.ttlk@gmail.com ]
China 
24-Oct-14 23:4627.159.202.53Nike00000nikeairmax01@yahoo.comChinaEvidence
24-Oct-14 23:46125.95.30.162hwuziehrobhw44@115mail.netChinaEvidence
24-Oct-14 23:46202.171.253.135iygtexzksindicatorcegg@gmail.com
[ indi.cator.cegg@gmail.com ]
Macao 
24-Oct-14 23:46193.201.224.2Beimecallealieugene4196@gmail.comUkraine 
24-Oct-14 23:46110.85.115.32ufcj1087producesnxa@gmail.com
[ pro.duce.sn.xa@gmail.com ]
ChinaEvidence
24-Oct-14 23:4627.159.252.27fsdsfsromkdebtorkotets@gmail.com
[ d.eb.to.rkot.ets@gmail.com ]
ChinaEvidence
24-Oct-14 23:46125.86.7.5Charksemmiftpxs@newssportsjapan.comChina 
24-Oct-14 23:46192.74.236.243iygtexzksindicatorcegg@gmail.com
[ indi.cator.cegg@gmail.com ]
United States 
24-Oct-14 23:4571.173.145.58Richardoljefflove12456@gmail.comUnited StatesEvidence
24-Oct-14 23:4562.210.97.80NDrechslemdcranksj@yahoo.com.hkFrance 
24-Oct-14 23:45110.89.52.140lnnvdebhooysagentrralpy@gmail.com
[ age.ntrr.a.l.p.y@gmail.com ]
China 
24-Oct-14 23:4591.213.93.64xprcarleysqsoahsudecampsa@yahoo.comKazakhstan 
24-Oct-14 23:4527.159.208.141ljdedseyrohauleisuredwra@gmail.com
[ l.eis.ure.d.wr.a@gmail.com ]
ChinaEvidence
24-Oct-14 23:45120.203.214.147DROMstephaniastella323@spambog.ruChinaEvidence
24-Oct-14 23:45116.236.216.116fdsgdhdtojbeyondaqzgga@gmail.com
[ be.y.o.n.d.a.q.z.g.g.a@gmail.com ]
China 
24-Oct-14 23:4527.150.197.101nike air max 1 damen idealovgtbfrtyug8@gmail.comChina 
24-Oct-14 23:45110.4.24.175maimusgoogleta5688seo6kaei@gmail.comHong Kong 
24-Oct-14 23:4591.200.12.79petegarajilynn9999ukra232kt@gmail.comUkraineEvidence
24-Oct-14 23:45117.26.252.158fdsgdhdtojbeyondaqzgga@gmail.com
[ be.y.o.n.d.a.q.z.g.g.a@gmail.com ]
China 
24-Oct-14 23:4527.159.255.217pasyaermpwlongtermuaklbw@gmail.com
[ l.o.ng.t.ermua.klb.w@gmail.com ]
China 
24-Oct-14 23:45120.43.23.189pasyaertektabulaterzom@gmail.com
[ ta.bulate.r.zom@gmail.com ]
China 
24-Oct-14 23:45120.43.9.6nike free reduziert herrenlkuygt6654ffd@gmail.comChina 
24-Oct-14 23:4527.153.164.81ljdwefdsyrozuyfeatureuhhv@gmail.com
[ f.e.at.u.re.uhh.v@gmail.com ]
China 
24-Oct-14 23:4537.57.231.125AbizyaloHotkisorjeronimo@gmail.comUkraineEvidence
24-Oct-14 23:45111.1.32.22CLhanzhuochengan@163.comChina 
24-Oct-14 23:45222.77.205.116fdhfghrt7ofghftset@163.comChinaEvidence
24-Oct-14 23:4527.159.210.210pacdffgsvdrmrzinstructqfho@gmail.com
[ i.nstruc.tq.f.ho@gmail.com ]
China 
24-Oct-14 23:45180.180.100.164IBrisenoileneynpc9965@pjmanufacturing.comThailand 
24-Oct-14 23:4562.210.38.5NVtshingledg@yahoo.com.hkFrance 
24-Oct-14 23:45178.137.0.147FrancisZokskadrlviv2@wegas.ruUkraine 
24-Oct-14 23:45120.43.29.109pasyaerpancontendergizp@gmail.com
[ c.o.nten.de.r.g.i.z.p@gmail.com ]
China 
24-Oct-14 23:4580.93.126.254Twipheriedeon1s23@inbox.ruUkraine 
24-Oct-14 23:4514.110.176.215Deriaduopoushvdw@newsinhouse.comChina 
24-Oct-14 23:4514.110.176.215bummjytavakwk@newsinhouse.comChina 
24-Oct-14 23:4514.110.176.215Vexsvmfenqdi@newsinhouse.comChina 
24-Oct-14 23:45222.79.139.100ginteiB3bchenrongshengwangzhenyu@gmail.com
[ c.hen.ro.n.g.shengwangzhenyu@gmail.com ]
ChinaEvidence
24-Oct-14 23:45222.79.139.100ginteiR2bchenrongshengwangzhenyu@gmail.com
[ che.nro.n.g.shengwangzhenyu@gmail.com ]
ChinaEvidence
24-Oct-14 23:45190.37.102.137patrickmnray5058susanxr1024@gmail.com
[ s.u.s.an.x.r.1.02.4@gmail.com ]
Venezuela 
24-Oct-14 23:45155.254.114.4VDbenniemqdkcwr081@outlook.comUnited States 
24-Oct-14 23:45134.249.48.26Autuqasrautuqa93@gmail.comUkraineEvidence
24-Oct-14 23:4546.185.13.184WOWUnloageruwowdat@yandex.comUkraineEvidence
24-Oct-14 23:4558.22.156.226xbssnzuilheospeijueslec52s@gmail.com
[ h.e.os.peij.u.esl.e.c52s@gmail.com ]
ChinaEvidence
24-Oct-14 23:4527.159.208.141pasyaermjwleisuredwra@gmail.com
[ leis.u.r.edwr.a@gmail.com ]
China 
24-Oct-14 23:45155.254.114.4EFmaganeckymij9079@outlook.comUnited States 
24-Oct-14 23:4537.57.200.173veltHogygeorebdizzyctxaxd@ymail.comUkraineEvidence
24-Oct-14 23:4558.22.156.226xbssnzuilheospeijueslec52s@gmail.com
[ h.e.os.peij.u.esl.e.c52s@gmail.com ]
ChinaEvidence
24-Oct-14 23:45175.44.7.162zcbecggmksiuwosedjuwos@gmail.com
[ ks.i.u.w.o.s.ed.j.uw.os@gmail.com ]
ChinaEvidence
24-Oct-14 23:45155.254.114.4ZDyuettebpnbnmh961@outlook.comUnited States 
24-Oct-14 23:45125.95.30.162bdgzxvjaprhb12@115mail.netChinaEvidence
24-Oct-14 23:45120.37.236.91nike free run fuer kinderkufs@gmail.comChina 
24-Oct-14 23:45120.37.208.80iu1p5qerer56tytyjyukjyuj@126.comChinaEvidence
24-Oct-14 23:45104.128.16.131R65Ddirefulmisfit1oc02r@ovi.com 
24-Oct-14 23:4514.110.176.215gotmhtfulpzgn@newsinhouse.comChina 
24-Oct-14 23:45195.211.154.168Douglaskivariationwya@gmail.comUkraineEvidence
24-Oct-14 23:45110.85.115.32so5914103producesnxa@gmail.com
[ prod.uce.sn.xa@gmail.com ]
ChinaEvidence
24-Oct-14 23:4561.154.15.43bqqfqnypadaniellyanr@hotmail.comChinaEvidence
24-Oct-14 23:4582.102.24.33RobertMiwynes105kerena@hotmail.comPortugal 
24-Oct-14 23:4527.153.238.29ciayfqcvgiwngzmialeon@gmail.com
[ n.gz.mi.al.e.on@gmail.com ]
China 
24-Oct-14 23:45120.37.234.159ljdwefdsyrofydconsumerkzybzs@gmail.com
[ c.o.n.su.merk.zy.bz.s@gmail.com ]
China 
24-Oct-14 23:4537.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
24-Oct-14 23:4595.67.184.144AshBrielsleonid340i@gmail.comRussian FederationEvidence
24-Oct-14 23:4576.164.206.122TemyPsymnjdufhsnchd8888854754@gmail.com
[ jdu.f.h.snchd.8.8.8.88.5.4.7.5.4@gmail.com ]
United StatesEvidence
24-Oct-14 23:4523.250.66.246jermainevolzvvodmlecavailablejacketofn@yahoo.com 
24-Oct-14 23:45221.232.57.176BernardKipxiyangyang1124@hotmail.comChinaEvidence
24-Oct-14 23:45110.89.26.94pasyaerdcdbaleenudulpk@gmail.com
[ bal.e.e.n.ud.u.l.p.k@gmail.com ]
ChinaEvidence
24-Oct-14 23:45176.31.18.225perlazafnGlyisraelchang30@gmail.com
[ israelchang30+548842184@gmail.com ]
FranceEvidence
24-Oct-14 23:4527.159.211.88ljdwefdsyrohifcanaryjyehdh@gmail.com
[ c.an.ary.jy.e.h.dh@gmail.com ]
ChinaEvidence
24-Oct-14 23:455.138.25.54Ataronfumjohnnieuj@yandex.comRussian FederationEvidence
24-Oct-14 23:45195.211.155.138MdIEUeeoaEretirementdwgma@gmail.com
[ reti.re.m.e.n.tdwgm.a@gmail.com ]
Ukraine 
24-Oct-14 23:45186.94.49.91abrdattsy7494susanxr1024@gmail.com
[ s.usa.nxr.1.0.24@gmail.com ]
Venezuela 
24-Oct-14 23:45195.211.155.138TdSJJjrocAretirementdwgma@gmail.com
[ ret.i.rem.en.td.wg.ma@gmail.com ]
Ukraine 
24-Oct-14 23:45195.211.155.138JtWGTnmukQretirementdwgma@gmail.com
[ r.et.ire.ment.dwgm.a@gmail.com ]
Ukraine 
24-Oct-14 23:45120.43.23.189pasyaeredwtabulaterzom@gmail.com
[ tab.u.la.terz.o.m@gmail.com ]
ChinaEvidence
24-Oct-14 23:4591.213.72.199caitlyngaskinxigggadecampsa@yahoo.comKazakhstan 
24-Oct-14 23:4527.153.166.231ljdwefdsyroriaseverelypded@gmail.com
[ se.v.er.el.ypd.ed@gmail.com ]
ChinaEvidence
24-Oct-14 23:45195.211.155.138GwDKLhteiFretirementdwgma@gmail.com
[ r.et.i.re.me.n.t.dwgma@gmail.com ]
Ukraine 
24-Oct-14 23:4527.153.218.248q29a28spsettlementqdlb@gmail.com
[ se.t.t.le.m.entqdlb@gmail.com ]
ChinaEvidence
24-Oct-14 23:4527.159.198.95pacdffgsvdrdkamarketingpgjn@gmail.com
[ m.a.r.ket.ing.pg.jn@gmail.com ]
China 
24-Oct-14 23:45212.83.189.36PDcharlesbrotherton785@discardmail.comFranceEvidence
24-Oct-14 23:44195.211.155.138EtJOLgmlpUretirementdwgma@gmail.com
[ re.ti.r.em.en.td.w.gma@gmail.com ]
Ukraine 
24-Oct-14 23:4437.57.200.173crangecycleabobbylitle@cmail.comUkraineEvidence
24-Oct-14 23:44195.211.155.138XwCQEpwklLretirementdwgma@gmail.com
[ r.etir.e.mentdw.g.ma@gmail.com ]
Ukraine 
24-Oct-14 23:445.138.25.54Aeronsopdanielbype@yandex.comRussian FederationEvidence
24-Oct-14 23:4427.159.202.53Qq99090755nikeairmax01@163.comChina 
24-Oct-14 23:44125.95.30.162hwuziehrobhw44@115mail.netChinaEvidence
24-Oct-14 23:44120.43.8.252very cheap nike shoxzdgdfgdfghdfh@gmail.comChina 
24-Oct-14 23:44120.37.227.152iikj0p2yde35ythrtgrfdv@126.comChinaEvidence
24-Oct-14 23:4446.118.112.28CynziaKtcynzia92@gmail.comUkraineEvidence
24-Oct-14 23:4427.153.209.228xoje5110sedimentvrpt@gmail.com
[ s.ediment.v.rpt@gmail.com ]
ChinaEvidence
24-Oct-14 23:44222.77.227.58v78a86jgbirthrightvqcb@gmail.com
[ bir.th.r.igh.tvqcb@gmail.com ]
ChinaEvidence
24-Oct-14 23:4427.159.212.134ffcxsdhdyzpneptunefgfuki@gmail.com
[ n.ep.tu.n.efg.f.u.ki@gmail.com ]
China 
24-Oct-14 23:4474.211.96.183FQelderlyskin10ieyz@yahoo.comUnited States 
24-Oct-14 23:44175.44.4.129nsgg43fxxamwingls993lgnzongbuyes@gmail.com
[ wi.ngls.99.3lgn.z.ongbuyes@gmail.com ]
ChinaEvidence
24-Oct-14 23:44183.207.229.4GQricardo7881@yahoo.comChina 
24-Oct-14 23:4462.205.84.44Gregorygregone-1986@hotmail.comBelgium 
24-Oct-14 23:44195.211.155.143BhRYUcenaJunfairgsbzb@gmail.com
[ u.n.f.a.i.rgsbz.b@gmail.com ]
Ukraine 
24-Oct-14 23:44120.37.209.92mtkgjx93pe2associatezqlv@gmail.com
[ a.sso.ciate.zq.l.v@gmail.com ]
ChinaEvidence
24-Oct-14 23:445.164.153.116AshBrielsleonid340i@gmail.comRussian FederationEvidence
24-Oct-14 23:44190.204.87.4FeOUWkhonWsusanxr1024@gmail.com
[ s.u.sa.n.xr.10.2.4@gmail.com ]
Venezuela 
24-Oct-14 23:4427.159.205.198rqfgdhguehskepticalzighul@gmail.com
[ s.k.e.p.ti.calzi.ghu.l@gmail.com ]
China 
24-Oct-14 23:44178.137.0.147FrancisZokskadrlviv2@wegas.ruUkraine 
24-Oct-14 23:4436.250.176.99cjkmyo149tuqugjudnktn3s@gmail.com
[ t.u.q.ugju.dn.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:4436.250.176.99zdiqikacb5tuqugjudnktn3s@gmail.com
[ tu.qugj.u.dn.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:44186.93.26.109Jaiclemiaseo6kaei@gmail.comVenezuela 
24-Oct-14 23:44110.89.52.140lnnvdebhooysagentrralpy@gmail.com
[ age.ntrr.a.l.p.y@gmail.com ]
China 
24-Oct-14 23:4427.159.255.217pasyaergoglongtermuaklbw@gmail.com
[ lon.g.t.e.rm.u.a.k.lbw@gmail.com ]
China 
24-Oct-14 23:4427.153.209.228j88a84xusedimentvrpt@gmail.com
[ se.d.im.e.n.tv.rpt@gmail.com ]
ChinaEvidence
24-Oct-14 23:44108.62.82.74IMoorecarolynnnocotuo@outlook.comUnited States 
24-Oct-14 23:44117.169.1.97RMeredithpmariani2b@gmx.frChina 
24-Oct-14 23:44175.44.4.148yybfjvyfclaowapdiseuw1@gmail.com
[ lao.w.a.p.d.i.s.e.uw1@gmail.com ]
ChinaEvidence
24-Oct-14 23:4477.121.142.102kurmapexhurisbod21@yandex.ruUkraine 
24-Oct-14 23:4436.250.176.99palczstog5tuqugjudnktn3s@gmail.com
[ tu.qu.g.j.u.dn.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:4427.159.202.53Qq99090755nikeairmax01@163.comChinaEvidence
24-Oct-14 23:44175.44.6.3snbzatccsadbmnd12456@gmail.com
[ s.a.d.b.m.n.d.124.56@gmail.com ]
ChinaEvidence
24-Oct-14 23:44118.97.95.182Breendajylfrbeyourselffor@gmail.comIndonesia 
24-Oct-14 23:44199.15.233.187Breendajylfrbeyourselffor@gmail.comUnited States 
24-Oct-14 23:4469.12.72.29IYguilderpens@yahoo.comUnited States 
24-Oct-14 23:4474.211.96.247tommieulknequrvxcdsdbrightscrutiny6sw@yahoo.comUnited States 
24-Oct-14 23:44120.33.216.93xtufbihrwshalawawo265@gmail.com
[ shal.awa.w.o265@gmail.com ]
ChinaEvidence
24-Oct-14 23:44108.177.254.65benjaminz19ghvvaenyleddyamies2780@discardmail.comUnited States 
24-Oct-14 23:4427.153.164.81ljdwefdsyrozuyfeatureuhhv@gmail.com
[ f.e.at.u.re.uhh.v@gmail.com ]
China 
24-Oct-14 23:4491.200.12.53FeOUWkhonWsusanxr1024@gmail.com
[ s.u.sa.n.xr.10.2.4@gmail.com ]
Ukraine 
24-Oct-14 23:4437.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
24-Oct-14 23:4491.207.6.58thudgeDuhbest@zpse.pp.uaUkraineEvidence
24-Oct-14 23:4495.67.184.144AshBrielsleonid340i@gmail.comRussian FederationEvidence
24-Oct-14 23:44125.95.30.162tlnbtukbpesv22@115mail.netChinaEvidence
24-Oct-14 23:44222.77.201.199kfgfdhddrqphenomenonhjozf@gmail.com
[ ph.e.n.o.m.e.n.o.nh.jo.zf@gmail.com ]
China 
24-Oct-14 23:44110.89.26.30rqfgdhgkvegallopkvyarx@gmail.com
[ ga.l.lo.pk.v.yarx@gmail.com ]
China 
24-Oct-14 23:44125.95.30.162gyyhtukknxrx94@115mail.netChinaEvidence
24-Oct-14 23:4346.200.51.33Jaiclemiaseo6kaei@gmail.comUkraine 
24-Oct-14 23:43120.198.243.99MQ72ildacianfrini21643@hotmail.comChinaEvidence
24-Oct-14 23:43117.169.1.77CAroholrochan1983@yahoo.comChina 
24-Oct-14 23:43120.37.208.160nike shox silber pinkytru@gmail.comChina 
24-Oct-14 23:4337.57.231.125AbizyaloHotkisorjeronimo@gmail.comUkraineEvidence
24-Oct-14 23:43117.26.86.22gsbaeg684w3scd6twhp1ox3p5qh8@yeah.netChinaEvidence
24-Oct-14 23:4327.150.243.70huaxypfs219laowiusdaheghjsa@gmail.com
[ lao.wiu.sda.heg.hjsa@gmail.com ]
ChinaEvidence
24-Oct-14 23:43120.37.230.246omhthyd935radggerscb@gmail.com
[ r.adgg.ersc.b@gmail.com ]
ChinaEvidence
24-Oct-14 23:43117.26.86.22gsesdq413z1hma6gmqv66v4k1gn8@yeah.netChinaEvidence
24-Oct-14 23:43222.77.229.126Charlesdutwhitkvfff@hotmail.comChinaEvidence
24-Oct-14 23:4395.181.178.142Antonekeninekitt9@daufond.ruRussian Federation 
24-Oct-14 23:43134.249.48.26Autuqasrautuqa93@gmail.comUkraineEvidence
24-Oct-14 23:4331.3.192.15JZQTBjames@forexrefiller.comUkraine 
24-Oct-14 23:43192.74.236.243wxowoavjzindicatorcegg@gmail.com
[ in.d.i.ca.tor.cegg@gmail.com ]
United States 
24-Oct-14 23:43222.77.227.58v78a86jgbirthrightvqcb@gmail.com
[ bir.th.r.igh.tvqcb@gmail.com ]
ChinaEvidence
24-Oct-14 23:43121.205.212.56nike free 5.0 v4 stylefilehjms@gmail.comChina 
24-Oct-14 23:43117.26.86.22gsxcap012g8fvb9offi2qy8x8kc8@yeah.netChinaEvidence
24-Oct-14 23:43117.26.86.22dimv2439ajhah1ptrv07x7d2cq7@yeah.netChinaEvidence
24-Oct-14 23:4327.159.194.65fbfgbrzffsegmentvvmihv@gmail.com
[ seg.m.e.n.tv.v.mi.h.v@gmail.com ]
China 
24-Oct-14 23:43117.26.86.22gsvrvt199x7ztc7dv0p6388q6wo0@yeah.netChinaEvidence
24-Oct-14 23:43110.89.61.240xspynaqylidealrdsfwfqks@gmail.com
[ i.de.al.rds.f.w.fq.k.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:43192.171.255.54shellak35gapocqbhtjtsayrewkn@yahoo.comUnited States 
24-Oct-14 23:4327.19.156.205btduxffsnoezarit03@gugoumail.comChinaEvidence
24-Oct-14 23:43222.77.205.116fgurhft3yfhfdtet@163.comChinaEvidence
24-Oct-14 23:4336.250.176.99lzrgtl335tuqugjudnktn3s@gmail.com
[ t.uqu.g.ju.d.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:43122.96.59.105GabrielaTbengyoulei91897@163.comChina 
24-Oct-14 23:4327.159.255.55pasyaerlxtdawningrobhcq@gmail.com
[ d.awning.r.o.b.hc.q@gmail.com ]
China 
24-Oct-14 23:43198.100.149.177R00Obvecounceg@yahoo.co.ukCanada 
24-Oct-14 23:43178.137.0.147FrancisZokskadrlviv2@wegas.ruUkraine 
24-Oct-14 23:43140.237.15.170tiffany ring pricesftjf@gmail.comChina 
24-Oct-14 23:43120.37.207.163FG4i6DFDfg436td@163.comChinaEvidence
24-Oct-14 23:43175.44.4.129nhdan93d73wingls993lgnzongbuyes@gmail.com
[ wi.ngl.s99.3lgn.z.ongbuyes@gmail.com ]
ChinaEvidence
24-Oct-14 23:4336.250.176.99bauuptpy1tuqugjudnktn3s@gmail.com
[ t.uq.u.g.j.u.d.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:43120.37.209.92mtkgjx93pe2associatezqlv@gmail.com
[ a.sso.ciate.zq.l.v@gmail.com ]
ChinaEvidence
24-Oct-14 23:43111.243.251.162RobertEredwardtote@outlook.comTaiwan, Province of China 
24-Oct-14 23:4327.159.252.27yiyhngdjygmidebtorkotets@gmail.com
[ de.bt.o.r.kotet.s@gmail.com ]
China 
24-Oct-14 23:4327.153.209.228j88a84xusedimentvrpt@gmail.com
[ se.d.im.e.n.tv.rpt@gmail.com ]
ChinaEvidence
24-Oct-14 23:43195.211.154.168Douglaskivariationwya@gmail.comUkraineEvidence
24-Oct-14 23:43120.33.216.151ljseyrocelrandomtixuyg@gmail.com
[ r.and.o.m.tix.u.y.g@gmail.com ]
China 
24-Oct-14 23:43199.15.233.173Giselledtmbeyourselffor@gmail.comUnited States 
24-Oct-14 23:4327.159.212.134ffcxsdhdyzpneptunefgfuki@gmail.com
[ n.ep.tu.n.efg.f.u.ki@gmail.com ]
China 
24-Oct-14 23:4391.207.6.58thudgeDuhbest@zpse.pp.uaUkraineEvidence
24-Oct-14 23:43222.77.206.1697f4n33krytrtyhdfhb8@gmail.com
[ r.tyhd.f.h.b8@gmail.com ]
ChinaEvidence
24-Oct-14 23:4237.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
24-Oct-14 23:42110.82.132.154uir5q6fg56fdy456yjdt@163.comChinaEvidence
24-Oct-14 23:4227.153.170.220fphkhegzfify266@eiakr.comChinaEvidence
24-Oct-14 23:42110.86.186.139fpbln82143jokeraa54107338@gmail.com
[ j.o.ker.a.a5.4.10.7.33.8@gmail.com ]
ChinaEvidence
24-Oct-14 23:42125.95.30.162hwuziehrobhw44@115mail.netChinaEvidence
24-Oct-14 23:42110.89.52.33PqFNFktdkIretirementdwgma@gmail.com
[ r.et.i.remen.tdwgma@gmail.com ]
ChinaEvidence
24-Oct-14 23:42110.82.132.154gj8i9tgt67jnmftr5yfhg@163.comChinaEvidence
24-Oct-14 23:42222.77.227.61Josie76788juanita1133@163.comChinaEvidence
24-Oct-14 23:42212.83.189.36UVcharlesbrotherton785@discardmail.comFrance 
24-Oct-14 23:42222.77.205.116fhretf7gdfh4565yue@163.comChinaEvidence
24-Oct-14 23:4227.159.215.199Rtyj8171carierasmiths1988@gmail.com
[ c.ar.ie.ras.miths1988@gmail.com ]
ChinaEvidence
24-Oct-14 23:42110.85.106.74nike air max direct reviewhggfffhjo987jh@gmail.comChina 
24-Oct-14 23:42110.85.103.58qbry6a39hdrainozauqb@gmail.com
[ d.rain.oza.uqb@gmail.com ]
China 
24-Oct-14 23:42192.161.165.219alexanderavdyikquusableabdomen41xl@yahoo.comUnited States 
24-Oct-14 23:42110.85.72.254c3064gnscrudelyxirt@gmail.com
[ cru.de.l.y.xirt@gmail.com ]
ChinaEvidence
24-Oct-14 23:42107.150.59.178casiegolderiekydongdszuba@yahoo.com 
24-Oct-14 23:42199.15.233.173Ameliauogbeyourselffor@gmail.comUnited StatesEvidence
24-Oct-14 23:4269.12.72.29YBglamorouser@yahoo.comUnited States 
24-Oct-14 23:4246.118.112.28CynziaKtcynzia92@gmail.comUkraineEvidence
24-Oct-14 23:4231.23.231.229Chelseahedochelseaeine777@gmail.comRussian Federation 
24-Oct-14 23:4236.250.176.99pryldqvkuhjtuqugjudnktn3s@gmail.com
[ tu.qug.judnktn.3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:42110.85.102.119rg2srcwm1untreatedyxcrmx@gmail.com
[ u.n.t.r.ea.t.e.dyxcrmx@gmail.com ]
China 
24-Oct-14 23:4223.229.77.205clairbeauvaisuxxjossifiedfaithlenb891@outlook.com 
24-Oct-14 23:42110.89.52.140lnnvdebhooysagentrralpy@gmail.com
[ age.ntrr.a.l.p.y@gmail.com ]
China 
24-Oct-14 23:42110.89.34.180kl3kdd1t1l2oiugghryhghsd@yeah.netChina 
24-Oct-14 23:4262.210.97.80MBeachamvhradomske@yahoo.com.hkFrance 
24-Oct-14 23:4236.250.176.99xlpkwxakz1tuqugjudnktn3s@gmail.com
[ tu.qu.g.j.ud.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:4236.250.176.99zqhdeukhv0tuqugjudnktn3s@gmail.com
[ tuq.ugjud.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:425.164.153.116AshBrielsleonid340i@gmail.comRussian FederationEvidence
24-Oct-14 23:4227.159.208.141ljdedseyromfyleisuredwra@gmail.com
[ l.e.isu.re.dwr.a@gmail.com ]
China 
24-Oct-14 23:4227.153.235.68nike shox r3 paiement par paypalmkg@gmail.comChina 
24-Oct-14 23:4236.250.176.99utbrmucz42tuqugjudnktn3s@gmail.com
[ t.u.q.u.g.j.udn.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:42110.89.12.187fgyrtygg7afgjhfgyr@126.comChinaEvidence
24-Oct-14 23:4227.153.164.81ljdwefdsyrozuyfeatureuhhv@gmail.com
[ f.e.at.u.re.uhh.v@gmail.com ]
China 
24-Oct-14 23:42222.77.229.126Charlesdutwhitkvfff@hotmail.comChinaEvidence
24-Oct-14 23:4227.159.255.55ljdedseyroispdawningrobhcq@gmail.com
[ d.awn.ingrobhc.q@gmail.com ]
China 
24-Oct-14 23:4269.12.70.118SEleonquxsjgf571@outlook.comUnited States 
24-Oct-14 23:4227.159.202.53Qq99090755nikeairmax03@yahoo.comChinaEvidence
24-Oct-14 23:4260.182.33.184LavernOxeqingxiewacong6@163.comChina 
24-Oct-14 23:42117.26.252.65ThomasSoblchers@hotmail.comChinaEvidence
24-Oct-14 23:4291.207.7.165Vallexpeviede3vbr1zk659@gmail.comUkraineEvidence
24-Oct-14 23:4227.19.156.205btduxffsnoezarit03@gugoumail.comChinaEvidence
24-Oct-14 23:42175.44.6.3snbzatccsadbmnd12456@gmail.com
[ s.a.d.b.m.n.d.124.56@gmail.com ]
ChinaEvidence
24-Oct-14 23:4227.159.252.42ffcxsdhddcihypothesisylrsnq@gmail.com
[ h.y.p.othe.s.i.s.y.l.rsn.q@gmail.com ]
China 
24-Oct-14 23:4262.210.114.49UFimontgomero@yahoo.com.hkFrance 
24-Oct-14 23:42120.37.227.152iiu9c3redwdbtrhuyjrfgd@126.comChinaEvidence
24-Oct-14 23:42178.137.0.147FrancisZokskadrlviv2@wegas.ruUkraine 
24-Oct-14 23:42167.114.23.65SHawkinssh4manking@hotmail.comUnited States 
24-Oct-14 23:42125.95.30.162tlnbtukbpesv22@115mail.netChinaEvidence
24-Oct-14 23:42125.78.217.160hgfjs07xpfhjdf8s8@163.comChinaEvidence
24-Oct-14 23:4227.159.252.27fsdsfsrfuhblgaujunior@gotmail.comChina 
24-Oct-14 23:42196.196.18.82ZConinghagantioremo1983@yahoo.comSeychelles 
24-Oct-14 23:42198.245.51.205QGcbuhlerjcfo@yahoo.co.ukCanada 
24-Oct-14 23:4227.159.252.27fsdsfsrfuhdebtorkotets@gmail.com
[ deb.to.r.ko.te.ts@gmail.com ]
China 
24-Oct-14 23:42110.89.34.36fgyeryhd0wjkgyjkyfk@163.comChinaEvidence
24-Oct-14 23:42110.89.52.33RsYHZttdcTunfairgsbzb@gmail.com
[ u.nfai.rg.sb.zb@gmail.com ]
ChinaEvidence
24-Oct-14 23:42120.37.234.166pacdffgsvdrbrcopponentdfiw@gmail.com
[ o.p.pon.entd.f.iw@gmail.com ]
China 
24-Oct-14 23:4291.207.9.138Pseursiorriesclunievov@gmail.comUkraineEvidence
24-Oct-14 23:4191.200.12.53DkMTLnhmgPdrainagelikvad@gmail.com
[ dr.ain.a.ge.l.i.kva.d@gmail.com ]
UkraineEvidence
24-Oct-14 23:4180.72.35.84JPDSTwilber3852@ally.co.plPoland 
24-Oct-14 23:41120.43.9.13nike free 2.0 pinkdzgdfhgfhfgh@gmail.comChina 
24-Oct-14 23:415.138.25.54Abaronsopzvchris@yandex.comRussian FederationEvidence
24-Oct-14 23:41125.95.30.162lxwdxhayhegl99@115mail.netChinaEvidence
24-Oct-14 23:41110.89.52.33VjMWPeckwLretirementdwgma@gmail.com
[ re.t.ir.eme.n.td.w.gma@gmail.com ]
ChinaEvidence
24-Oct-14 23:41134.249.48.26Autuqasrautuqa93@gmail.comUkraineEvidence
24-Oct-14 23:4137.57.200.173veltHogygeorebdizzyctxaxd@ymail.comUkraineEvidence
24-Oct-14 23:4136.250.176.99vjfjxx109tuqugjudnktn3s@gmail.com
[ t.uq.ugj.ud.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:41125.95.30.162gyyhtukknxrx94@115mail.netChinaEvidence
24-Oct-14 23:4136.250.176.99palyufulg6tuqugjudnktn3s@gmail.com
[ t.u.qugj.u.dn.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:41222.79.126.192lealfupledesing298048d@gmail.comChinaEvidence
24-Oct-14 23:4136.250.176.99bautdaob1tuqugjudnktn3s@gmail.com
[ t.uq.ugjudnktn.3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:41198.245.51.205RUsluwkeytvccde@yahoo.co.ukCanada 
24-Oct-14 23:4146.200.51.33BymnAsyncseo6kaei@gmail.comUkraine 
24-Oct-14 23:41120.43.29.53kffhfggdtjiacceleratetwxtpi@gmail.com
[ a.cc.e.l.e.ra.t.etwx.tpi@gmail.com ]
ChinaEvidence
24-Oct-14 23:41195.211.154.168Douglaskivariationwya@gmail.comUkraineEvidence
24-Oct-14 23:4127.159.194.65ltdfdrfdoaxxsegmentvvmihv@gmail.com
[ s.e.gm.en.t.vvm.ih.v@gmail.com ]
China 
24-Oct-14 23:41175.42.47.66Edwardtupsxrxn7329gf@e2.nmgllx.comChina 
24-Oct-14 23:41120.37.207.174shoogephypeleopoldoqja@hotmail.comChinaEvidence
24-Oct-14 23:4127.153.217.66Uliy2j0y7no2m68cw4o3e6n0i@126.comChinaEvidence
24-Oct-14 23:41110.89.52.140fnbhhfcrvwcagentrralpy@gmail.com
[ ag.entr.r.alp.y@gmail.com ]
ChinaEvidence
24-Oct-14 23:4136.250.176.99ngdohfua15tuqugjudnktn3s@gmail.com
[ tu.qugju.dn.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:4137.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
24-Oct-14 23:4137.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
24-Oct-14 23:4146.164.178.208William1986Syncwilliam1986brer@gmail.comUkraine 
24-Oct-14 23:4127.159.198.95pacdffgsvdrjuymarketingpgjn@gmail.com
[ mar.k.e.ti.ngp.gj.n@gmail.com ]
ChinaEvidence
24-Oct-14 23:4114.110.176.215ljappyvibldomzbh@sportsinjapan.comChinaEvidence
24-Oct-14 23:4127.159.196.201ljdwefdsyrouvkindenturerknr@gmail.com
[ i.n.denturer.k.n.r@gmail.com ]
China 
24-Oct-14 23:4137.59.56.42eqbakiqiibohan@asddddmail.orgFranceEvidence
24-Oct-14 23:41110.85.72.254c3064gnscrudelyxirt@gmail.com
[ cru.de.l.y.xirt@gmail.com ]
ChinaEvidence
24-Oct-14 23:41110.82.132.154ioy5z04gtyts3i4y5c@163.comChinaEvidence
24-Oct-14 23:41125.95.30.162yjxbepmlhiug56@115mail.netChinaEvidence
24-Oct-14 23:4127.153.204.133i9860bbnwrithesplr@gmail.com
[ wr.ith.e.spl.r@gmail.com ]
ChinaEvidence
24-Oct-14 23:4114.110.176.215ljappykvlldomies@sportsinjapan.comChinaEvidence
24-Oct-14 23:41125.78.241.20kid8snh74bct2skcdf8is@wixcmm.comChinaEvidence
24-Oct-14 23:4191.214.128.1661dketsanoi@bestfromthebest.usa.ccUkraineEvidence
24-Oct-14 23:4127.159.212.134ffcxsdhdyzpneptunefgfuki@gmail.com
[ n.ep.tu.n.efg.f.u.ki@gmail.com ]
China 
24-Oct-14 23:41120.33.216.151ljseyrosfqrandomtixuyg@gmail.com
[ rand.o.m.t.ixu.yg@gmail.com ]
China 
24-Oct-14 23:41193.201.224.46ucjmpagunwicrhin5d4@hotmail.comUkraine 
24-Oct-14 23:41120.43.23.189pasyaermzftabulaterzom@gmail.com
[ tab.ul.ater.zo.m@gmail.com ]
China 
24-Oct-14 23:41178.137.0.147FrancisZokskadrlviv2@wegas.ruUkraine 
24-Oct-14 23:41125.95.30.162tlnbtukbpesv22@115mail.netChinaEvidence
24-Oct-14 23:4127.159.215.199Rtyj8171carierasmiths1988@gmail.com
[ c.ar.ie.ras.miths1988@gmail.com ]
ChinaEvidence
24-Oct-14 23:4180.72.35.84MHustonardella7436@abos.co.plPoland 
24-Oct-14 23:4127.159.233.7h4x3a00nl7outputyydk@gmail.com
[ ou.t.pu.t.y.yd.k@gmail.com ]
ChinaEvidence
24-Oct-14 23:4179.52.130.201CarinDionworjucieragunnells@bk.ruItaly 
24-Oct-14 23:4161.155.169.11Ameliayepbeyourselffor@gmail.comChina 
24-Oct-14 23:41222.76.72.148bqqfqnypadaniellyanr@hotmail.comChinaEvidence
24-Oct-14 23:41199.15.233.172Ameliayepbeyourselffor@gmail.comUnited States 
24-Oct-14 23:41222.77.229.126Charlesdutwhitkvfff@hotmail.comChinaEvidence
24-Oct-14 23:4127.159.202.53Nike00000nikeairmax03@yahoo.comChinaEvidence
24-Oct-14 23:41175.44.4.129nhdac29z28wingls993lgnzongbuyes@gmail.com
[ w.i.n.gls.9.93lgn.z.ongbuyes@gmail.com ]
ChinaEvidence
24-Oct-14 23:4027.153.160.88FG6l9DFUIfg436es@126.comChinaEvidence
24-Oct-14 23:4036.250.176.99mmkvodfbc9tuqugjudnktn3s@gmail.com
[ t.u.q.u.gjudnktn.3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:4036.250.176.99bauhqlto6tuqugjudnktn3s@gmail.com
[ tuqu.g.jud.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:40110.89.52.140lnnvdebhooysagentrralpy@gmail.com
[ age.ntrr.a.l.p.y@gmail.com ]
China 
24-Oct-14 23:40109.169.233.170AshBrielsleonid340i@gmail.comRussian FederationEvidence
24-Oct-14 23:4027.159.196.201ljdwefdsyrojrsindenturerknr@gmail.com
[ i.n.dentur.er.k.n.r@gmail.com ]
ChinaEvidence
24-Oct-14 23:40110.89.52.33EbXIXokirAunfairgsbzb@gmail.com
[ u.nfairg.s.b.z.b@gmail.com ]
ChinaEvidence
24-Oct-14 23:40120.37.208.80iuy6k3ddcs3wyttyyuk@126.comChinaEvidence
24-Oct-14 23:4091.200.12.53CkSCWxrgfSdrainagelikvad@gmail.com
[ dr.ai.n.ag.e.lik.vad@gmail.com ]
UkraineEvidence
24-Oct-14 23:40178.137.160.199muvabepfeorifiheya@asdjmail.orgUkraineEvidence
24-Oct-14 23:40110.82.132.154gftyu0a54hyi0d1c6d@163.comChinaEvidence
24-Oct-14 23:4036.250.176.99jxkignol78tuqugjudnktn3s@gmail.com
[ t.uq.u.g.ju.dn.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:40188.165.251.205iuafaowukimokuba@aboutbothann.orgFranceEvidence
24-Oct-14 23:4027.153.164.81ljdwefdsyrozuyfeatureuhhv@gmail.com
[ f.e.at.u.re.uhh.v@gmail.com ]
China 
24-Oct-14 23:40110.82.132.154ioy9h54gtytqky0m7l@163.comChinaEvidence
24-Oct-14 23:4027.159.205.198rfxcvcgdhgbfdskepticalzighul@gmail.com
[ sk.e.pt.i.calz.i.ghul@gmail.com ]
ChinaEvidence
24-Oct-14 23:4027.19.156.205btduxffsnoezarit03@gugoumail.comChinaEvidence
24-Oct-14 23:4091.214.128.1661dDrumsancism@bestfromthebest.usa.ccUkraineEvidence
24-Oct-14 23:405.138.25.54Ataronsopjohnnieuj@yandex.comRussian FederationEvidence
24-Oct-14 23:4091.200.12.45Longchamp Pas Cher Cuirmfamhw@gmail.comUkraine 
24-Oct-14 23:4046.118.112.28CynziaKtcynzia92@gmail.comUkraineEvidence
24-Oct-14 23:40120.33.196.50Moncler UKepfzntxs@gmail.comChina 
24-Oct-14 23:40121.205.247.102cheap nike shox listdsgfsdfgdfgdf@gmail.comChina 
24-Oct-14 23:40202.106.16.36scurebsimirerxr0102@uggbuystorejp.comChina 
24-Oct-14 23:40195.211.155.143ByWMUrnjaUresolveksnvr@gmail.com
[ re.s.o.lveks.n.v.r@gmail.com ]
Ukraine 
24-Oct-14 23:40195.211.155.143ZsHXMjqetOresolveksnvr@gmail.com
[ reso.l.v.e.k.s.n.vr@gmail.com ]
Ukraine 
24-Oct-14 23:40193.201.224.158sasktehlservicd1576@gmail.com
[ serv.icd1.5.7.6@gmail.com ]
UkraineEvidence
24-Oct-14 23:40120.43.20.92cVKDg4JqyQcrobewbzar@yahoo.comChina 
24-Oct-14 23:40175.44.6.3snbzatccsadbmnd12456@gmail.com
[ s.a.d.b.m.n.d.124.56@gmail.com ]
ChinaEvidence
24-Oct-14 23:4037.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
24-Oct-14 23:40162.220.11.45rayfordbaccarinimeghanmajors8977@hulapla.de 
24-Oct-14 23:40125.95.30.162lxwdxhayhegl99@115mail.netChinaEvidence
24-Oct-14 23:4027.153.204.133i9860bbnwrithesplr@gmail.com
[ wr.ith.e.spl.r@gmail.com ]
ChinaEvidence
24-Oct-14 23:40120.43.20.92bqr7s3pRKjclaarknaca@yahoo.comChina 
24-Oct-14 23:4091.243.206.47jgrisijcgrisi@gmail.comUkraine 
24-Oct-14 23:4036.250.176.99zhisbaod22tuqugjudnktn3s@gmail.com
[ t.uqu.g.j.ud.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:4027.159.205.198rfxcvcgdhgkifskepticalzighul@gmail.com
[ s.ke.p.ticalz.igh.u.l@gmail.com ]
China 
24-Oct-14 23:40110.89.26.94fdsgdhdlorbaleenudulpk@gmail.com
[ b.al.e.e.n.u.d.ulpk@gmail.com ]
China 
24-Oct-14 23:4036.250.176.99pallevekz5tuqugjudnktn3s@gmail.com
[ t.uq.u.g.j.u.dn.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:4094.23.32.134BMjkglawmijh@yahoo.comFranceEvidence
24-Oct-14 23:40193.201.224.96aserbinqjyvlovergrace989656@gmail.com
[ lo.ve.rgrace989656@gmail.com ]
Ukraine 
24-Oct-14 23:4036.250.176.99asjiuthk23tuqugjudnktn3s@gmail.com
[ t.uq.u.gjud.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:40178.137.0.147FrancisZokskadrlviv2@wegas.ruUkraine 
24-Oct-14 23:4091.214.128.1661dketsanoi@bestfromthebest.usa.ccUkraineEvidence
24-Oct-14 23:40118.97.95.182Janicefptbeyourselffor@gmail.comIndonesia 
24-Oct-14 23:4091.200.12.24Fizissiolveguelphugo@gmail.comUkraine 
24-Oct-14 23:40199.15.233.187Janicefptbeyourselffor@gmail.comUnited States 
24-Oct-14 23:40120.37.228.203nike air max one essentialwewsd@gmail.comChina 
24-Oct-14 23:40125.95.30.162gyyhtukknxrx94@115mail.netChinaEvidence
24-Oct-14 23:4027.19.156.205otgqprcbnorbertf03@gugoumail.comChinaEvidence
24-Oct-14 23:39222.77.227.58qa4471503birthrightvqcb@gmail.com
[ b.irt.hri.gh.tvqcb@gmail.com ]
ChinaEvidence
24-Oct-14 23:39195.2.240.101govrbgmqyplftuav@vcciss.comRussian Federation 
24-Oct-14 23:39134.249.48.26Autuqasrautuqa93@gmail.comUkraineEvidence
24-Oct-14 23:3927.153.164.81pacdffgsvdryulfeatureuhhv@gmail.com
[ f.eatureu.hhv@gmail.com ]
China 
24-Oct-14 23:3927.159.211.88ljdwefdsyrocnccanaryjyehdh@gmail.com
[ c.a.na.ry.jyeh.d.h@gmail.com ]
China 
24-Oct-14 23:39125.95.30.162tlnbtukbpesv22@115mail.netChinaEvidence
24-Oct-14 23:39222.76.72.148bqqfqnypadaniellyanr@hotmail.comChinaEvidence
24-Oct-14 23:39198.245.51.205BJcbuhlerjcfo@yahoo.co.ukCanada 
24-Oct-14 23:39173.208.182.74つくば市 アークテリクスgmpirfr@gmail.comUnited States 
24-Oct-14 23:3969.12.72.29NJcankerousdcsq@yahoo.comUnited States 
24-Oct-14 23:3960.182.176.50MckinleyHzhuangpubojiu89@163.comChina 
24-Oct-14 23:3927.159.212.134ffcxsdhdyzpneptunefgfuki@gmail.com
[ n.ep.tu.n.efg.f.u.ki@gmail.com ]
China 
24-Oct-14 23:3927.153.250.9yp0h6m1k0rz2z91k3j3n9w6aplhf@163.comChinaEvidence
24-Oct-14 23:39109.169.233.170AshBrielsleonid340i@gmail.comRussian FederationEvidence
24-Oct-14 23:39120.43.11.41fgyrtyh4s5ty4576ytrdy@126.comChinaEvidence
24-Oct-14 23:39212.83.154.59christaperkinmfdjafsamiradumas9374@spambog.ruFrance 
24-Oct-14 23:3936.248.170.98salegoosedemaureen@asopenhrs.comChina 
24-Oct-14 23:39175.44.4.129nysfc6194awingls993lgnzongbuyes@gmail.com
[ wi.n.gl.s9.93lgn.z.ongbuyes@gmail.com ]
ChinaEvidence
24-Oct-14 23:3962.210.114.49REfrmcphied@yahoo.com.hkFrance 
24-Oct-14 23:3961.103.6.28JWankevinmcgeer@yahoo.comRepublic of Korea 
24-Oct-14 23:3927.159.195.234lghfgghdonatmodestlyfettlk@gmail.com
[ m.ode.s.t.ly.fet.t.l.k@gmail.com ]
China 
24-Oct-14 23:3991.214.128.1661dlyncanjasy@bestfromthebest.usa.ccUkraineEvidence
24-Oct-14 23:39199.15.233.137Howardfutfghnjmuykiulio@mail.ruUnited States 
24-Oct-14 23:3936.250.176.99yojutlkmv5tuqugjudnktn3s@gmail.com
[ tuq.u.g.j.u.d.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:39193.201.224.30wbjzluqstsuwoxtc9o6@hotmail.comUkraineEvidence
24-Oct-14 23:39195.211.154.168Douglaskivariationwya@gmail.comUkraineEvidence
24-Oct-14 23:3914.110.176.215Quetzmsdervca@blogshoponline.comChina 
24-Oct-14 23:3923.19.176.226TYNYuttermostlesionk@ovi.comUnited States 
24-Oct-14 23:3936.250.176.99zhiskcoz28tuqugjudnktn3s@gmail.com
[ t.uq.ug.j.ud.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:3962.210.97.46RKtisteinfj@yahoo.com.hkFrance 
24-Oct-14 23:39125.78.217.160hgfjs07xpfhjdf8s8@163.comChinaEvidence
24-Oct-14 23:3936.250.176.99bauetjzu8tuqugjudnktn3s@gmail.com
[ t.u.q.u.gjud.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:3969.12.72.29JRbenzoicendo@yahoo.comUnited States 
24-Oct-14 23:3936.250.176.99palzzbcdv1tuqugjudnktn3s@gmail.com
[ t.u.q.ug.j.ud.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:39216.244.71.3Georgecomneldaagd@hotmail.comUnited States 
24-Oct-14 23:39110.89.34.36gfu6yhh8xfhytydrty@163.comChinaEvidence
24-Oct-14 23:3927.19.156.205btduxffsnoezarit03@gugoumail.comChinaEvidence
24-Oct-14 23:39110.89.52.140lnnvdebhooysagentrralpy@gmail.com
[ age.ntrr.a.l.p.y@gmail.com ]
China 
24-Oct-14 23:3991.243.206.47StephenPlfdgjfykjyk@gmail.comUkraine 
24-Oct-14 23:39110.86.186.139pmjb5e780mwjokeraa54107338@gmail.com
[ joker.a.a5.41.07.33.8@gmail.com ]
ChinaEvidence
24-Oct-14 23:39178.70.105.29Smeappymybdclips@gmail.comRussian FederationEvidence
24-Oct-14 23:39193.201.224.158sasktehlservicd1576@gmail.com
[ serv.icd1.5.7.6@gmail.com ]
UkraineEvidence
24-Oct-14 23:3927.153.164.81ljdwefdsyrozuyfeatureuhhv@gmail.com
[ f.e.at.u.re.uhh.v@gmail.com ]
China 
24-Oct-14 23:395.138.25.54Ataronfumjohnnieuj@yandex.comRussian FederationEvidence
24-Oct-14 23:3977.121.142.102kurmadomhurisbod21@yandex.ruUkraine 
24-Oct-14 23:39178.137.0.147FrancisZokskadrlviv2@wegas.ruUkraine 
24-Oct-14 23:395.164.153.116AshBrielsleonid340i@gmail.comRussian FederationEvidence
24-Oct-14 23:3950.115.171.169hudsonturgeonuddywlottaamirixmt@yahoo.comUnited States 
24-Oct-14 23:39120.43.31.47ljdedseyroktuappointjmxwno@gmail.com
[ appoin.tjm.xw.no@gmail.com ]
China 
24-Oct-14 23:39120.43.23.189ljdedseyrowultabulaterzom@gmail.com
[ t.abu.la.t.er.zo.m@gmail.com ]
ChinaEvidence
24-Oct-14 23:385.15.54.111CalvinRahmeghannoonypfn039@outlook.comRomania 
24-Oct-14 23:38110.85.100.103fdsgdhdfmxstoutehekex@gmail.com
[ sto.ute.he.ke.x@gmail.com ]
ChinaEvidence
24-Oct-14 23:3878.9.146.188LCalineoddo@spamavert.comPoland 
24-Oct-14 23:385.138.25.54Anaronfumgtwilliam@yandex.comRussian FederationEvidence
24-Oct-14 23:3827.159.205.198rqfgdhgzfuskepticalzighul@gmail.com
[ ske.pt.i.c.a.l.zi.ghu.l@gmail.com ]
ChinaEvidence
24-Oct-14 23:38188.165.251.205ofufupaletaalojonivi@aboutbothann.orgFranceEvidence
24-Oct-14 23:3837.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
24-Oct-14 23:38195.211.155.143elesytexaxda8310resolveksnvr@gmail.com
[ r.e.so.l.v.ek.s.n.v.r@gmail.com ]
Ukraine 
24-Oct-14 23:3891.214.128.1661dDrumsancism@bestfromthebest.usa.ccUkraineEvidence
24-Oct-14 23:3814.110.176.215lMoivabxtlhomqqp@sportsinjapan.comChina 
24-Oct-14 23:3846.235.64.220Michaelgugsyytitiyyyitys@mail.ruRussian Federation 
24-Oct-14 23:38199.15.233.167Breendazfjmjbeyourselffor@gmail.comUnited States 
24-Oct-14 23:3862.210.114.9SWaggonerretakequ@outlook.comFrance 
24-Oct-14 23:38183.223.212.248how to hack wifi passworddominga_reiniger@yahoo.comChina 
24-Oct-14 23:38184.164.141.39kristingarlingtaclaireknappqvy@yahoo.comUnited States 
24-Oct-14 23:38201.242.252.187CMmobeloak12@outlook.comVenezuela 
24-Oct-14 23:38173.208.193.82asaredner85ycolebrookry@live.comUnited States 
24-Oct-14 23:38125.95.30.162yjxbepmlhiug56@115mail.netChinaEvidence
24-Oct-14 23:38222.77.224.52kiaqgkaxelaowiusdaheghjsa@gmail.com
[ laowi.u.s.da.h.eg.hjsa@gmail.com ]
ChinaEvidence
24-Oct-14 23:385.138.25.54Aparonfumanthonynem@yandex.comRussian FederationEvidence
24-Oct-14 23:3836.250.176.99asjifaeu69tuqugjudnktn3s@gmail.com
[ t.uq.u.gju.d.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:3846.161.41.11Danielmryacasika6@mail.ruRussian FederationEvidence
24-Oct-14 23:38110.82.132.154mfg0q1cg6fgu6t8jkji@163.comChinaEvidence
24-Oct-14 23:3836.33.31.47vhdfnsdjsbazhaoanjia17@126.comChinaEvidence
24-Oct-14 23:3846.118.112.28CynziaKtcynzia92@gmail.comUkraineEvidence
24-Oct-14 23:38125.95.30.162lxwdxhayhegl99@115mail.netChinaEvidence
24-Oct-14 23:3827.159.205.198rqfgdhgsqaskepticalzighul@gmail.com
[ s.kepticalz.i.gh.ul@gmail.com ]
China 
24-Oct-14 23:3837.57.231.125AbizyaloTowkisorjeronimo@gmail.comUkraineEvidence
24-Oct-14 23:3836.250.176.99orszjgvd65tuqugjudnktn3s@gmail.com
[ t.u.qug.ju.dn.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:3836.250.176.99twstlq552tuqugjudnktn3s@gmail.com
[ tu.qug.ju.dn.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:38219.93.183.102YrXRYlrxbIunfairgsbzb@gmail.com
[ un.f.a.i.r.g.s.bzb@gmail.com ]
Malaysia 
24-Oct-14 23:3814.110.176.215lFewmyrlvekqye@sportsinjapan.comChina 
24-Oct-14 23:38110.82.132.154ioy9x44gtytefv9j1j@163.comChinaEvidence
24-Oct-14 23:3837.57.200.173crangecycleabobbylitle@cmail.comUkraineEvidence
24-Oct-14 23:3837.57.200.173veltHogygeorebdizzyctxaxd@ymail.comUkraineEvidence
24-Oct-14 23:38110.82.132.154ioy6i04gtytelj8a2n@163.comChinaEvidence
24-Oct-14 23:38195.211.155.143YrXRYlrxbIunfairgsbzb@gmail.com
[ un.f.a.i.r.g.s.bzb@gmail.com ]
Ukraine 
24-Oct-14 23:3814.110.176.215lcausarvllsnodynvy@sportsinjapan.comChina 
24-Oct-14 23:38107.155.80.183darrellprattvtxfcharlotyandellxmt@yahoo.com 
24-Oct-14 23:3891.214.128.1661dlyncanjasy@bestfromthebest.usa.ccUkraineEvidence
24-Oct-14 23:3827.159.230.216t49x36bphumbleemrn@gmail.com
[ h.u.m.b.lee.mr.n@gmail.com ]
ChinaEvidence
24-Oct-14 23:38193.201.224.126ReahUtetuagmaddaavviidd123nk@gmail.comUkraine 
24-Oct-14 23:3894.23.4.121DSjikilgourimq@yahoo.comFrance 
24-Oct-14 23:3836.250.176.99jfupzujtqbetuqugjudnktn3s@gmail.com
[ t.u.qug.judnktn.3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:38110.82.132.196nhl jerseys rankingsdfghgvchch@gmail.comChina 
24-Oct-14 23:3858.242.212.167vhdfnsdjsbazhaoanjia17@126.comChinaEvidence
24-Oct-14 23:38175.44.6.3snbzatccsadbmnd12456@gmail.com
[ s.a.d.b.m.n.d.124.56@gmail.com ]
ChinaEvidence
24-Oct-14 23:38195.211.154.168Douglaskivariationwya@gmail.comUkraineEvidence
24-Oct-14 23:3850.115.171.169gailfelizbajsqaluchristyfriedmanrde@yahoo.comUnited States 
24-Oct-14 23:3827.159.196.201ljdwefdsyrodftindenturerknr@gmail.com
[ inden.t.u.r.e.r.kn.r@gmail.com ]
China 
24-Oct-14 23:3827.150.220.245Aj7XYalin4hrw8dnchakop@gmail.com
[ hr.w.8d.n.ch.ak.op@gmail.com ]
ChinaEvidence
24-Oct-14 23:38192.3.132.237isidrarountreenmavailablejacketofn@yahoo.comUnited States 
24-Oct-14 23:38113.57.252.104RMilakroonwqlo@yahoo.comChina 
24-Oct-14 23:38187.139.203.52santosvivierrfvqqinjkaciesfporcello@yahoo.comMexico 
24-Oct-14 23:38134.249.48.26Autuqasrautuqa93@gmail.comUkraineEvidence
24-Oct-14 23:3827.159.212.134ffcxsdhdyzpneptunefgfuki@gmail.com
[ n.ep.tu.n.efg.f.u.ki@gmail.com ]
China 
24-Oct-14 23:38183.224.1.55bdizzycjnioray1932bdizzycjnioray@cmail.orgChina 
24-Oct-14 23:3827.153.164.55PuBGFsbhiYunfairgsbzb@gmail.com
[ u.nfai.r.g.sbzb@gmail.com ]
ChinaEvidence
24-Oct-14 23:38120.37.208.80ii3f8veedriufthuikjtyghre@126.comChinaEvidence
24-Oct-14 23:38195.211.155.143RiFVNllhlBresolveksnvr@gmail.com
[ re.s.o.lvek.sn.v.r@gmail.com ]
Ukraine 
24-Oct-14 23:37178.137.0.147FrancisZokskadrlviv2@wegas.ruUkraine 
24-Oct-14 23:37125.78.217.160hgfja42tkfhjds8dd@163.comChinaEvidence
24-Oct-14 23:37122.96.59.105ljdwefdsyropvnmarketingpgjn@gmail.com
[ ma.rk.e.ti.ngpg.jn@gmail.com ]
China 
24-Oct-14 23:3714.110.176.215lSLOBEqzrlpsypeodt@sportsinjapan.comChina 
24-Oct-14 23:37120.37.231.86cvaeqfqmmaqchetownat@gmail.com
[ c.he.town.a.t@gmail.com ]
China 
24-Oct-14 23:3736.250.176.99iccgyxvo38tuqugjudnktn3s@gmail.com
[ tu.q.u.g.j.udn.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:37125.78.217.160ddfgj8q1emkfod9s0@163.comChinaEvidence
24-Oct-14 23:37125.78.217.160tv854y98snllg0f0d0@163.comChinaEvidence
24-Oct-14 23:3727.159.198.95ljdwefdsyropvnmarketingpgjn@gmail.com
[ ma.rk.e.ti.ngpg.jn@gmail.com ]
China 
24-Oct-14 23:37125.78.217.160q41w3v62lmcvd9sfd@163.comChinaEvidence
24-Oct-14 23:37125.78.217.160iofm245tx0kk9f9dsd@163.comChinaEvidence
24-Oct-14 23:37125.78.217.160oogfr52l8kkf99gdf@163.comChinaEvidence
24-Oct-14 23:37125.78.217.160fjdkz53a8lglfdf9f@163.comChinaEvidence
24-Oct-14 23:3727.159.211.88ljdwefdsyrotqjcanaryjyehdh@gmail.com
[ ca.nary.jye.hd.h@gmail.com ]
ChinaEvidence
24-Oct-14 23:3746.200.51.33cingunjuhseo6kaei@gmail.comUkraine 
24-Oct-14 23:37125.95.30.162hwuziehrobhw44@115mail.netChinaEvidence
24-Oct-14 23:3791.207.5.10nSpPZpYq2vmacmillan.h@yandex.ruUkraine 
24-Oct-14 23:3779.133.204.132VVLNbarriesimxjil@outlook.comPoland 
24-Oct-14 23:3727.150.231.60wdwrz87185jokeraa54107338@gmail.com
[ jo.ker.a.a.5410.73.3.8@gmail.com ]
ChinaEvidence
24-Oct-14 23:37120.37.242.82nike shox rivalry noir et blanchebreakjhgf6uhj@gmail.comChina 
24-Oct-14 23:37193.201.224.132Thomasenyourmail@gmail.comUkraine 
24-Oct-14 23:37125.95.30.162tlnbtukbpesv22@115mail.netChinaEvidence
24-Oct-14 23:3776.164.226.10tugkpwpthbvhfyr64567f@gmail.comUnited States 
24-Oct-14 23:37110.85.115.32zj6604855producesnxa@gmail.com
[ p.rodu.ce.sn.xa@gmail.com ]
ChinaEvidence
24-Oct-14 23:37110.86.189.191cheap nike air max 90 in ukjytuyt65dfca@gmail.comChina 
24-Oct-14 23:3737.57.231.125AbizyaloTowkisorjeronimo@gmail.comUkraineEvidence
24-Oct-14 23:37222.77.227.58xlln8920devisevjxy@gmail.com
[ de.v.is.e.vjx.y@gmail.com ]
ChinaEvidence
24-Oct-14 23:37183.203.22.92OHdustymattocks@ama-trade.deChina 
24-Oct-14 23:37120.202.249.201fdddevfrqylmodestlyfettlk@gmail.com
[ mod.e.st.l.yfet.tlk@gmail.com ]
China 
24-Oct-14 23:3727.153.164.81ljdwefdsyrozuyfeatureuhhv@gmail.com
[ f.e.at.u.re.uhh.v@gmail.com ]
China 
24-Oct-14 23:37199.15.233.173Janicemlvbeyourselffor@gmail.comUnited States 
24-Oct-14 23:37192.171.255.54elanabluettgpcrcgkurycarmelrnv@yahoo.comUnited States 
24-Oct-14 23:37110.89.34.232sdf0b747627fanaticsxyer@gmail.com
[ f.anat.ic.s.xyer@gmail.com ]
ChinaEvidence
24-Oct-14 23:37198.245.51.205IKcbuhlerjcfo@yahoo.co.ukCanada 
24-Oct-14 23:375.164.153.116AshBrielsleonid340i@gmail.comRussian FederationEvidence
24-Oct-14 23:3737.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
24-Oct-14 23:37175.44.4.129nsgg98fygwbwingls993lgnzongbuyes@gmail.com
[ w.i.ngl.s.9.93lgn.z.ongbuyes@gmail.com ]
ChinaEvidence
24-Oct-14 23:37125.95.30.162lxwdxhayhegl99@115mail.netChinaEvidence
24-Oct-14 23:3727.159.255.217pasyaerhydlongtermuaklbw@gmail.com
[ l.o.ng.te.r.m.uakl.bw@gmail.com ]
China 
24-Oct-14 23:37117.26.254.182ljdwefdsyrorwnrescueuilc@gmail.com
[ re.scue.ui.lc@gmail.com ]
China 
24-Oct-14 23:37192.230.43.149rowenawhitesidevqellsworthonx@yahoo.comUnited States 
24-Oct-14 23:375.39.26.92EB16@6n.kinefi.plFrance 
24-Oct-14 23:3736.250.176.99fxmacp382tuqugjudnktn3s@gmail.com
[ t.uqu.gj.udnktn.3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:3780.72.35.84S4127cari20420@abut.co.plPoland 
24-Oct-14 23:37192.171.255.54hnajuanahqvssnqjvkhidianyw@yahoo.comUnited States 
24-Oct-14 23:3727.159.195.234fdddevfrqylmodestlyfettlk@gmail.com
[ mod.e.st.l.yfet.tlk@gmail.com ]
China 
24-Oct-14 23:37125.78.241.8wyonwthetpausgiir@newzbling.comChinaEvidence
24-Oct-14 23:37195.211.154.168Douglaskivariationwya@gmail.comUkraineEvidence
24-Oct-14 23:3727.19.156.205dtfuwftsnoezarit03@gugoumail.comChinaEvidence
24-Oct-14 23:37222.77.205.116fghdfgg3nhrfgfge@163.comChinaEvidence
24-Oct-14 23:37110.85.112.145nike shox qualify reviewdzfzsgfdgzdfg@gmail.comChina 
24-Oct-14 23:3746.235.64.220MichaelFurbyytitiyyyitys@mail.ruRussian Federation 
24-Oct-14 23:3791.207.6.58flaftittymr569507732@gmail.comUkraineEvidence
24-Oct-14 23:37110.82.132.154fh0i6ig68yj3xq7e4w9@163.comChinaEvidence
24-Oct-14 23:37222.77.227.58v78a86jgbirthrightvqcb@gmail.com
[ bir.th.r.igh.tvqcb@gmail.com ]
ChinaEvidence
24-Oct-14 23:3623.94.20.41heatherbrewingtontjejulineqx@yahoo.comUnited States 
24-Oct-14 23:3689.28.45.51Piperxkedmo86joesmithj1980@gmail.com
[ joesmithj1980+seo41@gmail.com ]
Moldova, Republic of 
24-Oct-14 23:36110.85.103.58o6sxv3y24drainozauqb@gmail.com
[ d.r.a.i.noz.a.uqb@gmail.com ]
China 
24-Oct-14 23:3636.250.176.99bauqgdtl0tuqugjudnktn3s@gmail.com
[ tu.qugj.ud.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:36178.137.0.147FrancisZokskadrlviv2@wegas.ruUkraine 
24-Oct-14 23:36222.77.227.58u7051gwxbirthrightvqcb@gmail.com
[ bi.r.thri.gh.tvqcb@gmail.com ]
ChinaEvidence
24-Oct-14 23:36120.37.227.152ure7h7mdes0rhnfgbvcv@126.comChinaEvidence
24-Oct-14 23:3668.71.139.176LSilviserminiacoodeycxnz@yahoo.comUnited States 
24-Oct-14 23:36120.37.209.92pbxghf515bacteriakpin@gmail.com
[ bacter.iak.p.in@gmail.com ]
ChinaEvidence
24-Oct-14 23:36110.82.132.154iuot2s6x9b0kta1l3f3@163.comChinaEvidence
24-Oct-14 23:3627.19.156.205otgqprcbnorbertf03@gugoumail.comChinaEvidence
24-Oct-14 23:3682.36.175.40Geraldptasicminer@bitcoin-cloud.meUnited Kingdom 
24-Oct-14 23:36117.27.138.181Ridediapavacalvoanxn@hotmail.comChina 
24-Oct-14 23:36222.77.205.116fyrgegye9fgufydsts@163.comChinaEvidence
24-Oct-14 23:36117.26.254.182ljdwefdsyromryrescueuilc@gmail.com
[ re.s.c.u.euilc@gmail.com ]
China 
24-Oct-14 23:3627.159.196.201ljdwefdsyroykuindenturerknr@gmail.com
[ i.nd.e.n.turerk.nr@gmail.com ]
China 
24-Oct-14 23:36193.201.224.158splapwvtservicd1576@gmail.com
[ ser.v.i.cd.1.5.7.6@gmail.com ]
UkraineEvidence
24-Oct-14 23:36110.82.132.154fh2u3hg68yjcrd4f9u7@163.comChinaEvidence
24-Oct-14 23:3646.118.112.28CynziaKtcynzia92@gmail.comUkraineEvidence
24-Oct-14 23:3614.110.176.215lwetftrljuidekvu@sportsinjapan.comChina 
24-Oct-14 23:3636.33.31.47vhdfnsdjsbazhaoanjia17@126.comChinaEvidence
24-Oct-14 23:3614.110.176.215lmatojglzefttf@sportsinjapan.comChina 
24-Oct-14 23:365.138.25.54Ataronfumjohnnieuj@yandex.comRussian FederationEvidence
24-Oct-14 23:36111.161.126.88OLlewelynjiuqiaoshaozhi9@163.comChina 
24-Oct-14 23:36110.85.69.119Carolinexcrpcaroline5541@163.comChinaEvidence
24-Oct-14 23:36110.85.115.32zj6604855producesnxa@gmail.com
[ p.rodu.ce.sn.xa@gmail.com ]
ChinaEvidence
24-Oct-14 23:36192.99.6.68XMivoryqsshil@yahoo.comCanada 
24-Oct-14 23:3637.57.231.125AbizyaloTowkisorjeronimo@gmail.comUkraineEvidence
24-Oct-14 23:36120.37.208.80hh0y2sfcdx8eyjyujyujy@126.comChinaEvidence
24-Oct-14 23:3691.236.74.251BCarpentia@atrais-kredits24.comPoland 
24-Oct-14 23:3637.57.231.125AbizyaloHotkisorjeronimo@gmail.comUkraineEvidence
24-Oct-14 23:3627.159.212.134ffcxsdhdyzpneptunefgfuki@gmail.com
[ n.ep.tu.n.efg.f.u.ki@gmail.com ]
China 
24-Oct-14 23:3627.159.205.198kfgfdhdyhmskepticalzighul@gmail.com
[ sk.ep.t.i.c.a.l.zig.h.u.l@gmail.com ]
China 
24-Oct-14 23:36120.37.208.80oibg8k8kcf6dythdfvsd@126.comChinaEvidence
24-Oct-14 23:3627.159.233.7hg17i9887gjokeraa54107338@gmail.com
[ j.o.ker.aa541073.3.8@gmail.com ]
ChinaEvidence
24-Oct-14 23:36222.77.229.218nike shox kidssdsss@gmail.comChina 
24-Oct-14 23:3636.250.176.99rtsnbbivbqhtuqugjudnktn3s@gmail.com
[ tuq.ugju.dn.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:36134.249.48.26Autuqasrautuqa93@gmail.comUkraineEvidence
24-Oct-14 23:3636.250.176.99kpmcdcomx0tuqugjudnktn3s@gmail.com
[ tu.qugju.d.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:36222.77.224.28new nike air max 95 releasevyyuctjyu@gmail.comChina 
24-Oct-14 23:3627.159.195.234fdddevfrrdemodestlyfettlk@gmail.com
[ modest.l.y.f.et.t.l.k@gmail.com ]
China 
24-Oct-14 23:3627.159.205.198rqfgdhgawhskepticalzighul@gmail.com
[ s.ke.pti.c.alzig.hu.l@gmail.com ]
China 
24-Oct-14 23:36222.77.227.58qa4471503birthrightvqcb@gmail.com
[ b.irt.hri.gh.tvqcb@gmail.com ]
ChinaEvidence
24-Oct-14 23:36199.15.233.173Janicemlvbeyourselffor@gmail.comUnited States 
24-Oct-14 23:3662.210.178.161TDeaseydizzyphysician5hhan@bk.ruFrance 
24-Oct-14 23:3662.210.38.5WQvtrcovinh@yahoo.com.hkFrance 
24-Oct-14 23:36110.89.41.173nfl jersey 4xl wholesalejhkh@gmail.comChina 
24-Oct-14 23:3627.153.216.214tixcuj334fvll0wd25q97qn3zn@yeah.netChinaEvidence
24-Oct-14 23:3627.159.210.210pacdffgsvdrwfwinstructqfho@gmail.com
[ i.ns.t.ruc.t.qfho@gmail.com ]
China 
24-Oct-14 23:3627.159.230.216t49x36bphumbleemrn@gmail.com
[ h.u.m.b.lee.mr.n@gmail.com ]
ChinaEvidence
24-Oct-14 23:36117.169.1.127bdzzycshtolze5559resolveksnvr@gmail.com
[ re.sol.veks.nv.r@gmail.com ]
China 
24-Oct-14 23:3694.23.251.168exatupivitbuadijiyoso@mailretor.comFranceEvidence
24-Oct-14 23:3627.159.194.65fbfbvrltgsegmentvvmihv@gmail.com
[ se.g.m.e.n.t.v.vm.ihv@gmail.com ]
China 
24-Oct-14 23:36175.44.4.228jerseyk87laowpsadisiaqwu1@gmail.com
[ la.ow.psad.i.sia.qwu1@gmail.com ]
ChinaEvidence
24-Oct-14 23:3627.153.209.228u5250irasedimentvrpt@gmail.com
[ s.edi.m.e.n.tv.rpt@gmail.com ]
ChinaEvidence
24-Oct-14 23:3658.48.35.191mopensdn12jslkpmnemcndm1234@gmail.comChinaEvidence
24-Oct-14 23:36175.44.4.228jahgdnc74laowpsadisiaqwu1@gmail.com
[ laow.psad.i.sia.qwu1@gmail.com ]
ChinaEvidence
24-Oct-14 23:35120.43.23.189pasyaercestabulaterzom@gmail.com
[ ta.bu.la.t.e.r.z.o.m@gmail.com ]
ChinaEvidence
24-Oct-14 23:35117.26.252.158rdgdgdhgkhbbeyondaqzgga@gmail.com
[ b.ey.o.n.da.q.z.gg.a@gmail.com ]
ChinaEvidence
24-Oct-14 23:35120.43.31.47pasyaerjjlappointjmxwno@gmail.com
[ a.ppo.i.n.t.j.m.x.wno@gmail.com ]
ChinaEvidence
24-Oct-14 23:3527.159.255.217pasyaerudhlongtermuaklbw@gmail.com
[ long.te.rm.u.a.k.lbw@gmail.com ]
ChinaEvidence
24-Oct-14 23:3527.159.196.201ljdwefdsyropatindenturerknr@gmail.com
[ ind.e.nt.urerkn.r@gmail.com ]
ChinaEvidence
24-Oct-14 23:35125.95.30.162lxwdxhayhegl99@115mail.netChinaEvidence
24-Oct-14 23:3537.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
24-Oct-14 23:3580.93.126.254Envenioffifyzuu0@mail.uaUkraineEvidence
24-Oct-14 23:3558.22.135.94bqqfqnypadaniellyanr@hotmail.comChinaEvidence
24-Oct-14 23:35222.77.227.58u7051gwxbirthrightvqcb@gmail.com
[ bi.r.thri.gh.tvqcb@gmail.com ]
ChinaEvidence
24-Oct-14 23:35178.137.0.147FrancisZokskadrlviv2@wegas.ruUkraine 
24-Oct-14 23:35183.160.190.174MaicCaftichlkssddlk@hotmail.comChinaEvidence
24-Oct-14 23:35222.79.126.192lealfupledesing298048d@gmail.comChinaEvidence
24-Oct-14 23:35178.215.96.88Cileseanisandrej.dimidoff@yandex.ruRussian Federation 
24-Oct-14 23:3537.57.200.173crangecycleabobbylitle@cmail.comUkraineEvidence
24-Oct-14 23:3537.48.80.175VXbernafzgjcjp@outlook.comNetherlandsEvidence
24-Oct-14 23:35195.211.154.168Douglaskivariationwya@gmail.comUkraineEvidence
24-Oct-14 23:35212.83.160.236MGoverjoyedteam42ltkka@inbox.ruFrance 
24-Oct-14 23:3527.153.164.81ljdwefdsyrozuyfeatureuhhv@gmail.com
[ f.e.at.u.re.uhh.v@gmail.com ]
China 
24-Oct-14 23:3572.252.159.113winniecarmonaknktorah3sar@yahoo.comJamaica 
24-Oct-14 23:3562.210.142.205hackingethiopianhackingethiopianyim@itregi.comFrance 
24-Oct-14 23:35110.85.100.103rfdsggdhggdostoutehekex@gmail.com
[ s.t.ou.teh.ek.e.x@gmail.com ]
China 
24-Oct-14 23:35193.201.224.48owfodcxupybgezsl5u1@hotmail.comUkraineEvidence
24-Oct-14 23:35120.43.29.53lddsffffdokscacceleratetwxtpi@gmail.com
[ a.cce.lera.t.e.tw.xt.pi@gmail.com ]
China 
24-Oct-14 23:355.164.153.116AshBrielsleonid340i@gmail.comRussian FederationEvidence
24-Oct-14 23:35211.143.146.239MoraEddingtonjingmu4967742529@163.comChina 
24-Oct-14 23:3527.19.156.205dtfuwftsnoezarit03@gugoumail.comChinaEvidence
24-Oct-14 23:3527.19.156.205otgqprcbnorbertf03@gugoumail.comChinaEvidence
24-Oct-14 23:3569.12.72.29PUguilderpens@yahoo.comUnited States 
24-Oct-14 23:35222.77.227.58v78a86jgbirthrightvqcb@gmail.com
[ bir.th.r.igh.tvqcb@gmail.com ]
ChinaEvidence
24-Oct-14 23:35175.44.4.129nysfw6130hwingls993lgnzongbuyes@gmail.com
[ wi.ng.ls.9.93lgn.z.ongbuyes@gmail.com ]
ChinaEvidence
24-Oct-14 23:35195.211.155.138CsCNWuwmnLretirementdwgma@gmail.com
[ r.e.tir.e.me.n.tdw.gm.a@gmail.com ]
Ukraine 
24-Oct-14 23:35195.211.155.138ZqUARqombQretirementdwgma@gmail.com
[ r.et.ir.e.me.n.td.w.g.m.a@gmail.com ]
Ukraine 
24-Oct-14 23:35193.201.224.158splapwvtservicd1576@gmail.com
[ ser.v.i.cd.1.5.7.6@gmail.com ]
UkraineEvidence
24-Oct-14 23:35125.95.30.162hwuziehrobhw44@115mail.netChinaEvidence
24-Oct-14 23:35186.94.176.7arobertsshtolzeay8358arobertsshtolzeay@ymail.comVenezuela 
24-Oct-14 23:35220.200.5.146hoTnZqsrddygmbutp2611@gmail.comChina 
24-Oct-14 23:3591.214.128.1661esseneaFangymn@bestfromthebest.usa.ccUkraineEvidence
24-Oct-14 23:35195.211.155.138OwTSBbvcrHretirementdwgma@gmail.com
[ r.eti.r.e.ment.dw.gma@gmail.com ]
Ukraine 
24-Oct-14 23:3536.250.176.99asjieueb35tuqugjudnktn3s@gmail.com
[ t.u.q.u.gj.u.dn.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:3537.57.231.125AbizyaloHotkisorjeronimo@gmail.comUkraineEvidence
24-Oct-14 23:3536.250.176.99qdgbboivglutuqugjudnktn3s@gmail.com
[ t.u.q.u.gju.d.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:3527.159.202.53Nike00000nikeairmax01@yahoo.comChina 
24-Oct-14 23:3527.19.156.205btduxffsnoezarit03@gugoumail.comChinaEvidence
24-Oct-14 23:35198.245.51.205UYcbuhlerjcfo@yahoo.co.ukCanada 
24-Oct-14 23:3579.133.204.132thorstenachenyufzwqimyrnavhpwrb@outlook.comPoland 
24-Oct-14 23:35192.74.236.243azwahqcxmindicatorcegg@gmail.com
[ i.nd.ic.ator.cegg@gmail.com ]
United States 
24-Oct-14 23:3514.110.176.215lSopsyolhlmoppmc@sportsinjapan.comChina 
24-Oct-14 23:3527.159.208.141ljdedseyropejleisuredwra@gmail.com
[ le.isu.redw.ra@gmail.com ]
ChinaEvidence
24-Oct-14 23:3527.159.210.210pacdffgsvdroskinstructqfho@gmail.com
[ inst.r.u.c.t.q.fho@gmail.com ]
ChinaEvidence
24-Oct-14 23:3527.159.194.65fbfbvreoxsegmentvvmihv@gmail.com
[ s.e.g.m.e.n.tv.vm.ihv@gmail.com ]
ChinaEvidence
24-Oct-14 23:35111.11.152.133Erika9698poudaoluanhuai05@163.comChina 
24-Oct-14 23:3514.110.176.215lBerdyglusastnjk@sportsinjapan.comChina 
24-Oct-14 23:3527.153.166.231pacdffgsvdrlpbseverelypded@gmail.com
[ s.ever.ely.p.d.e.d@gmail.com ]
ChinaEvidence
24-Oct-14 23:35222.77.227.58t66b76ujbirthrightvqcb@gmail.com
[ bi.r.t.hri.gh.tvqcb@gmail.com ]
ChinaEvidence
24-Oct-14 23:35110.85.113.205ytb8g0w7mx1xgfdhtfryerwytdfhf@163.comChinaEvidence
24-Oct-14 23:3591.243.206.47Stephenmexyfdgjfykjyk@gmail.comUkraineEvidence
24-Oct-14 23:3591.207.7.194gtptncvzecohfzin8sx@hotmail.comUkraine 
24-Oct-14 23:3591.207.6.58flaftittymr569507732@gmail.comUkraineEvidence
24-Oct-14 23:3546.118.113.196aceotaqulliufofewxa@emailrtg.orgUkraineEvidence
24-Oct-14 23:3536.33.31.47vhdfnsdjsbazhaoanjia17@126.comChinaEvidence
24-Oct-14 23:3527.159.208.141ljdedseyrokzcleisuredwra@gmail.com
[ l.e.i.sur.edwr.a@gmail.com ]
ChinaEvidence
24-Oct-14 23:35110.89.52.140lopygrvjvpnagentrralpy@gmail.com
[ ag.e.n.trra.l.py@gmail.com ]
ChinaEvidence
24-Oct-14 23:35110.85.103.120ljdwefdsyroynieerilympkf@gmail.com
[ ee.ri.l.y.mpk.f@gmail.com ]
ChinaEvidence
24-Oct-14 23:35211.143.146.239A5377clarencecorbett6446@mailcatch.comChina 
24-Oct-14 23:3527.156.99.30xurqtgpceplmdqvy6792@gmail.comChina 
24-Oct-14 23:34192.3.58.20mohammedbrelandreakasmeryiushk@yahoo.comUnited StatesEvidence
24-Oct-14 23:3446.185.13.184amilsqjunioray7290ruwowdat@yandex.comUkraine 
24-Oct-14 23:34110.86.189.13nike free pink neon kaufenlkmj897hgbvc@gmail.comChina 
24-Oct-14 23:3461.154.16.175bqqfqnypadaniellyanr@hotmail.comChinaEvidence
24-Oct-14 23:3446.185.13.184greorasyandexta1240ruwowdat@yandex.comUkraine 
24-Oct-14 23:34120.43.23.189pasyaeriwktabulaterzom@gmail.com
[ t.ab.ul.ate.r.zo.m@gmail.com ]
China 
24-Oct-14 23:3446.185.13.184bradajnay1616ruwowdat@yandex.comUkraine 
24-Oct-14 23:3494.23.251.168uxopomigfequeqaofu@mailretor.comFranceEvidence
24-Oct-14 23:3423.236.190.124CFifechelsea.fife71@josue.100paintingschallenge.com 
24-Oct-14 23:3427.159.194.65ltdfdrfdocxcsegmentvvmihv@gmail.com
[ s.e.g.m.en.tvvm.i.h.v@gmail.com ]
China 
24-Oct-14 23:34125.86.7.5Vierabygremahtf@shopjpguide.comChina 
24-Oct-14 23:34221.232.57.176BernardKipxiyangyang1124@hotmail.comChinaEvidence
24-Oct-14 23:3427.153.163.171Canada Goose UKdqqthj@gmail.comChina 
24-Oct-14 23:3446.185.13.184WOWUnfiniaruwowdat@yandex.comUkraine 
24-Oct-14 23:34202.108.50.74R56Ojuniorrosanove@mailcatch.comChina 
24-Oct-14 23:34222.77.227.58s0036qrzdevisevjxy@gmail.com
[ de.vis.ev.jx.y@gmail.com ]
ChinaEvidence
24-Oct-14 23:34175.44.4.228gevguklx1laowpsadisiaqwu1@gmail.com
[ lao.w.p.s.a.d.i.sia.qwu1@gmail.com ]
ChinaEvidence
24-Oct-14 23:34222.77.227.58xlln8920devisevjxy@gmail.com
[ de.v.is.e.vjx.y@gmail.com ]
ChinaEvidence
24-Oct-14 23:3427.159.212.134ffcxsdhdyzpneptunefgfuki@gmail.com
[ n.ep.tu.n.efg.f.u.ki@gmail.com ]
China 
24-Oct-14 23:34110.89.52.33LiJRZhtacQretirementdwgma@gmail.com
[ r.e.t.i.rem.ent.d.wg.m.a@gmail.com ]
ChinaEvidence
24-Oct-14 23:3437.57.200.173crangecycleabobbylitle@cmail.comUkraineEvidence
24-Oct-14 23:3437.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
24-Oct-14 23:34178.137.0.147FrancisZokskadrlviv2@wegas.ruUkraine 
24-Oct-14 23:3491.200.12.53MaGOSakzgQdrainagelikvad@gmail.com
[ d.r.a.in.ag.e.lik.v.a.d@gmail.com ]
UkraineEvidence
24-Oct-14 23:34199.15.233.187Donnaeebeyourselffor@gmail.comUnited States 
24-Oct-14 23:3427.159.230.216m67m72bchumbleemrn@gmail.com
[ hu.mb.l.e.emr.n@gmail.com ]
ChinaEvidence
24-Oct-14 23:3446.118.112.28CynziaKtcynzia92@gmail.comUkraineEvidence
24-Oct-14 23:345.39.26.95OX16@6n.kinefi.plFranceEvidence
24-Oct-14 23:3423.27.237.117IDriscolldarksongs921@yahoo.comUnited States 
24-Oct-14 23:3436.250.176.99zhisrefh48tuqugjudnktn3s@gmail.com
[ t.u.qu.gj.u.dn.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:3436.250.176.99baunfbbq0tuqugjudnktn3s@gmail.com
[ t.uqu.gjud.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:34120.37.208.80ccfg9b4qvf57hvjjkhgn@126.comChinaEvidence
24-Oct-14 23:34125.95.30.162lxwdxhayhegl99@115mail.netChinaEvidence
24-Oct-14 23:34110.82.169.177trdgbrd5c5ggdfgrsytuty@163.comChinaEvidence
24-Oct-14 23:3436.250.176.99ultscp584tuqugjudnktn3s@gmail.com
[ t.u.q.ug.j.u.dn.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:3436.250.176.99pkzkzjny49tuqugjudnktn3s@gmail.com
[ t.u.qug.jud.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:34222.77.225.133nike shox sale onlineminh87juiads@gmail.comChina 
24-Oct-14 23:34175.44.4.228jahmxml05laowpsadisiaqwu1@gmail.com
[ l.aowp.sa.d.i.sia.qwu1@gmail.com ]
ChinaEvidence
24-Oct-14 23:34175.44.4.228pkfwfp78laowpsadisiaqwu1@gmail.com
[ l.ao.w.psa.d.i.sia.qwu1@gmail.com ]
ChinaEvidence
24-Oct-14 23:34134.249.48.26Autuqasrautuqa93@gmail.comUkraineEvidence
24-Oct-14 23:3436.250.176.99fsssov283tuqugjudnktn3s@gmail.com
[ t.u.qu.gj.ud.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:3427.19.156.205dtfuwftsnoezarit03@gugoumail.comChinaEvidence
24-Oct-14 23:3437.239.46.26keizvdzllhfz147@eiakr.comIraq 
24-Oct-14 23:34125.95.30.162tlnbtukbpesv22@115mail.netChinaEvidence
24-Oct-14 23:34193.201.224.10keizvdzllhfz147@eiakr.comUkraine 
24-Oct-14 23:34106.3.40.249OrvilleKadsorvilledug@hotmail.comChina 
24-Oct-14 23:3437.57.200.173veltHogygeorebdizzyctxaxd@ymail.comUkraineEvidence
24-Oct-14 23:3427.159.252.42rfxcvcgdhgbbohypothesisylrsnq@gmail.com
[ hy.p.o.the.s.isy.lrs.nq@gmail.com ]
China 
24-Oct-14 23:3427.159.252.42ffcxsdhdrjfhypothesisylrsnq@gmail.com
[ hy.p.o.t.hesisyl.rs.nq@gmail.com ]
China 
24-Oct-14 23:34175.44.4.228qibxmrg7laowpsadisiaqwu1@gmail.com
[ l.aowps.a.di.sia.qwu1@gmail.com ]
ChinaEvidence
24-Oct-14 23:34190.201.168.140Evangelintwvbeyourselffor@gmail.comVenezuela 
24-Oct-14 23:3437.57.231.125AbizyaloHotkisorjeronimo@gmail.comUkraineEvidence
24-Oct-14 23:34199.15.233.173Evangelintwvbeyourselffor@gmail.comUnited States 
24-Oct-14 23:3427.159.194.65ltrgffdoecqsegmentvvmihv@gmail.com
[ s.e.g.me.n.tv.vmihv@gmail.com ]
China 
24-Oct-14 23:34125.78.218.35flight club new york air max 95huygyug@gmail.comChina 
24-Oct-14 23:3495.69.241.116RobertPlhxqpkhqwml@cutemailbox.comUkraine 
24-Oct-14 23:34220.226.187.131JMallankein89@gmail.com
[ allan.kein89@gmail.com ]
India 
24-Oct-14 23:3491.214.128.1661esseneaFangymn@bestfromthebest.usa.ccUkraineEvidence
24-Oct-14 23:34193.201.224.130RichardVogoversightvlzb@gmail.com
[ o.ve.r.sig.h.tv.l.z.b@gmail.com ]
Ukraine 
24-Oct-14 23:3437.48.80.173SSaqulrickrafertyiaokgf@yahoo.comNetherlands 
24-Oct-14 23:34110.86.186.139jp54v9476ejokeraa54107338@gmail.com
[ j.ok.eraa54.107338@gmail.com ]
ChinaEvidence
24-Oct-14 23:3427.159.205.198rqfgdhgdkwskepticalzighul@gmail.com
[ skep.t.ic.alz.i.gh.u.l@gmail.com ]
China 
24-Oct-14 23:3427.153.164.81ljdwefdsyrozuyfeatureuhhv@gmail.com
[ f.e.at.u.re.uhh.v@gmail.com ]
China 
24-Oct-14 23:34222.77.227.58qa4471503birthrightvqcb@gmail.com
[ b.irt.hri.gh.tvqcb@gmail.com ]
ChinaEvidence
24-Oct-14 23:34110.89.34.36gfhyryh4ygfujhgyrey@126.comChinaEvidence
24-Oct-14 23:3427.159.233.7rq08ui800outputyydk@gmail.com
[ out.p.ut.y.y.d.k@gmail.com ]
ChinaEvidence
24-Oct-14 23:3491.200.12.53KrBTZbyfcEsusanxr1024@gmail.com
[ s.usanxr1.024@gmail.com ]
Ukraine 
24-Oct-14 23:3427.19.156.205btduxffsnoezarit03@gugoumail.comChinaEvidence
24-Oct-14 23:34193.201.224.44Beimecallealiguelphugo@gmail.comUkraine 
24-Oct-14 23:33198.50.136.255JOmonsterour@yahoo.comCanada 
24-Oct-14 23:33120.37.227.152uy8v6hedss0jiojkytgd45fgf@126.comChinaEvidence
24-Oct-14 23:335.164.153.116AshBrielsleonid340i@gmail.comRussian FederationEvidence
24-Oct-14 23:33222.77.227.58u7051gwxbirthrightvqcb@gmail.com
[ bi.r.thri.gh.tvqcb@gmail.com ]
ChinaEvidence
24-Oct-14 23:33175.44.4.228uuuykzk09laowpsadisiaqwu1@gmail.com
[ laowp.s.adis.ia.qwu1@gmail.com ]
ChinaEvidence
24-Oct-14 23:33120.43.31.47pasyaerrxfappointjmxwno@gmail.com
[ ap.poi.n.t.j.mx.w.no@gmail.com ]
China 
24-Oct-14 23:3336.250.176.99jmhzygvxg6tuqugjudnktn3s@gmail.com
[ t.u.q.u.g.jud.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:33120.42.219.231qsacxh0bdi56isafw1@126.comChina 
24-Oct-14 23:3327.159.230.216t49x36bphumbleemrn@gmail.com
[ h.u.m.b.lee.mr.n@gmail.com ]
ChinaEvidence
24-Oct-14 23:3327.16.168.176xkedzdgsthomaslo04@gugoumail.comChinaEvidence
24-Oct-14 23:33110.82.157.110pacdffgsvdrvjjrawhidetfhe@gmail.com
[ ra.wh.i.de.tfh.e@gmail.com ]
China 
24-Oct-14 23:3336.250.176.99zhisngst98tuqugjudnktn3s@gmail.com
[ t.uqu.g.ju.dn.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:3336.250.176.99palwxktqx4tuqugjudnktn3s@gmail.com
[ tu.qugjud.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:33222.77.227.58s0036qrzdevisevjxy@gmail.com
[ de.vis.ev.jx.y@gmail.com ]
ChinaEvidence
24-Oct-14 23:3327.159.252.27lhggjfdooeadebtorkotets@gmail.com
[ de.bt.or.ko.tets@gmail.com ]
China 
24-Oct-14 23:33222.77.227.58t66b76ujbirthrightvqcb@gmail.com
[ bi.r.t.hri.gh.tvqcb@gmail.com ]
ChinaEvidence
24-Oct-14 23:3336.248.197.57Robertorcollum100@outlook.comChinaEvidence
24-Oct-14 23:3336.33.31.47vhdfnsdjsbazhaoanjia17@126.comChinaEvidence
24-Oct-14 23:33188.240.135.133STCPdcgykenyaparolini@list.ruRomania 
24-Oct-14 23:33110.89.52.33JjTEMcnkpJretirementdwgma@gmail.com
[ reti.r.eme.n.t.dwg.m.a@gmail.com ]
ChinaEvidence
24-Oct-14 23:33110.85.124.14cvxheotlczfz135@eiakr.comChina 
24-Oct-14 23:3327.19.156.205otgqprcbnorbertf03@gugoumail.comChinaEvidence
24-Oct-14 23:33180.180.100.135RJamarreginaldcobi4998@pjmanufacturing.comThailand 
24-Oct-14 23:33110.80.62.103cpmrnldjepgymnasticyiil@gmail.com
[ gymnasticyiil+cadfub@gmail.com ]
China 
24-Oct-14 23:33110.82.132.154fh7b5rg68yjpca4c3n0@163.comChinaEvidence
24-Oct-14 23:33178.137.0.147FrancisZokskadrlviv2@wegas.ruUkraine 
24-Oct-14 23:33112.111.160.196scurebsimirerxr0301@uggbuystorejp.comChina 
24-Oct-14 23:3327.159.230.216m67m72bchumbleemrn@gmail.com
[ hu.mb.l.e.emr.n@gmail.com ]
ChinaEvidence
24-Oct-14 23:33110.89.34.116cvd4421ylirmtyugjghj@163.comChinaEvidence
24-Oct-14 23:3362.210.82.148laynedqloxikwbxcejnguyethewlettofji@yahoo.comFrance 
24-Oct-14 23:3327.159.230.216e07r44nihumbleemrn@gmail.com
[ hum.b.lee.mr.n@gmail.com ]
ChinaEvidence
24-Oct-14 23:3391.200.12.64CSupershdowps101@vip.163.comUkraine 
24-Oct-14 23:3336.248.197.57Shikumatathcollum100@outlook.comChinaEvidence
24-Oct-14 23:3336.250.176.99iybcuhnk02tuqugjudnktn3s@gmail.com
[ tu.q.u.gju.d.n.k.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:3362.210.211.91BPmetenvbtpk@outlook.comFrance 
24-Oct-14 23:3337.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
24-Oct-14 23:33199.15.233.187Donnaeebeyourselffor@gmail.comUnited States 
24-Oct-14 23:33142.0.42.8AEppersontomhone@mailcatch.comUnited States 
24-Oct-14 23:33110.82.132.154fh3b7ig68yjukn9n7w3@163.comChinaEvidence
24-Oct-14 23:3362.210.78.209Arianacoco888@msn.comFranceEvidence
24-Oct-14 23:3362.210.78.209Austinincomeppc@hotmail.comFranceEvidence
24-Oct-14 23:3369.12.72.29VOdomicileoor@yahoo.comUnited States 
24-Oct-14 23:3362.210.78.209Landonbehappy@yahoo.comFranceEvidence
24-Oct-14 23:3362.210.78.209Kylieeblanned@yahoo.comFranceEvidence
24-Oct-14 23:3362.210.78.209infestcooler111@yahoo.comFranceEvidence
24-Oct-14 23:3327.19.156.205dtfuwftsnoezarit03@gugoumail.comChinaEvidence
24-Oct-14 23:3336.33.216.156vhdfnsdjsbazhaoanjia17@126.comChinaEvidence
24-Oct-14 23:3327.153.186.162nike free schuhe billigkjhhuoi89uyt@gmail.comChina 
24-Oct-14 23:33110.82.132.154iuot6x3k5m5cse1j8k9@163.comChinaEvidence
24-Oct-14 23:33200.7.91.254tallz101tallmancp055@gmail.com
[ tallman.cp055@gmail.com ]
Trinidad and Tobago 
24-Oct-14 23:33222.77.229.126Charlesdutwhitkvfff@hotmail.comChinaEvidence
24-Oct-14 23:33195.211.154.168Douglaskivariationwya@gmail.comUkraineEvidence
24-Oct-14 23:33213.149.12.66asbestova@inbox.ruRussian Federation 
24-Oct-14 23:33120.37.236.230gd17lm8f9ppdfkj0@163.comChinaEvidence
24-Oct-14 23:33175.44.4.228uicphx15laowpsadisiaqwu1@gmail.com
[ l.a.owps.a.di.sia.qwu1@gmail.com ]
ChinaEvidence
24-Oct-14 23:33125.95.30.162hwuziehrobhw44@115mail.netChinaEvidence
24-Oct-14 23:33198.245.51.205J6271uwkeytvccde@yahoo.co.ukCanada 
24-Oct-14 23:33110.82.132.154hjn5w3ghfgj567jrdrty@163.comChinaEvidence
24-Oct-14 23:33110.82.132.154fh6h5bg68yjyuf2w3r5@163.comChinaEvidence
24-Oct-14 23:33186.93.31.65EdENDlmviXresolveksnvr@gmail.com
[ r.es.olve.ksn.vr@gmail.com ]
Venezuela 
24-Oct-14 23:33112.111.52.13pnnptlyvekorzeppuw@hotmail.comChinaEvidence
24-Oct-14 23:33176.31.229.130LReelbrckhdltrpuyfd@hotmail.comFrance 
24-Oct-14 23:3327.159.212.134ffcxsdhdyzpneptunefgfuki@gmail.com
[ n.ep.tu.n.efg.f.u.ki@gmail.com ]
China 
24-Oct-14 23:33198.50.238.145dwainmackliniymuskinheadow@hotmail.comCanada 
24-Oct-14 23:3336.248.197.57Aureliapicollum100@outlook.comChinaEvidence
24-Oct-14 23:3346.119.115.110VoroninACleusheva.nadezhda@mail.ruUkraine 
24-Oct-14 23:33112.111.52.13imtcktvkmbemisyufaqin@hotmail.comChinaEvidence
24-Oct-14 23:33198.50.238.145tawannabluntvltyearbookm@hotmail.comCanada 
24-Oct-14 23:33111.11.153.13RZmainsheetymkxq@gmail.com
[ ma.i.n.sh.eet.y.m.kx.q@gmail.com ]
China 
24-Oct-14 23:3358.242.212.167vhdfnsdjsbazhaoanjia17@126.comChinaEvidence
24-Oct-14 23:33198.50.238.145wilfordmadgwickpriornomin@hotmail.comCanada 
24-Oct-14 23:3362.210.82.148franciscauavaogndxraneeschreursohgy@yahoo.comFrance 
24-Oct-14 23:33120.37.208.80ccd834bghnimhkhjgbfgh@163.comChinaEvidence
24-Oct-14 23:3346.164.235.197Pseursiorriesclunievov@gmail.comRussian FederationEvidence
24-Oct-14 23:33198.50.238.145shellieyuenkpgmfaintlyyga@hotmail.comCanada 
24-Oct-14 23:32182.118.23.7abrdativanovy8338abrdativanovy@e-mail.netChina 
24-Oct-14 23:3231.23.231.229Chelseaplchelseaeine777@gmail.comRussian Federation 
24-Oct-14 23:32193.201.224.48owfodcxupybgezsl5u1@hotmail.comUkraineEvidence
24-Oct-14 23:3258.61.29.233badizzyclttlea8049badizzyclttlea@e-mail.comChina 
24-Oct-14 23:32140.237.6.138526vogmo5conjoinwdvts@gmail.com
[ c.o.n.joi.nwdvts@gmail.com ]
ChinaEvidence
24-Oct-14 23:3236.250.176.99asjivsfx12tuqugjudnktn3s@gmail.com
[ t.u.q.u.gjud.nk.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:3236.250.176.99jcdbtzjun5tuqugjudnktn3s@gmail.com
[ t.u.qug.j.u.dnk.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:3236.250.176.99tsrzemijx0tuqugjudnktn3s@gmail.com
[ tu.q.u.gju.dnk.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:3236.250.176.99zhisgrhv78tuqugjudnktn3s@gmail.com
[ t.uqugj.u.dnk.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:3214.110.176.215mypeiredidoanm@blogshoponline.comChina 
24-Oct-14 23:32182.118.23.7bobbytopay7016bobbytopay@cmail.comChina 
24-Oct-14 23:32195.211.155.143EdENDlmviXresolveksnvr@gmail.com
[ r.es.olve.ksn.vr@gmail.com ]
Ukraine 
24-Oct-14 23:32140.206.86.68Weellessexr0102@uggbuystorejp.comChina 
24-Oct-14 23:32120.37.207.163JK9TYz22x3g45rfdsfd@126.comChinaEvidence
24-Oct-14 23:32134.249.48.26Autuqasrautuqa93@gmail.comUkraineEvidence
24-Oct-14 23:32111.225.75.30hmmaxinyuqytskjyx@163.comChinaEvidence
24-Oct-14 23:32120.202.249.201lhggjfdorijdebtorkotets@gmail.com
[ deb.tork.o.te.ts@gmail.com ]
China 
24-Oct-14 23:3227.153.228.111kjjbghgrejoportioniluoig@gmail.com
[ p.o.rti.o.ni.l.u.o.ig@gmail.com ]
ChinaEvidence
24-Oct-14 23:3236.250.176.99palhjcrwe2tuqugjudnktn3s@gmail.com
[ tu.qug.ju.dnk.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:32199.15.233.172Janicenuxbeyourselffor@gmail.comUnited States 
24-Oct-14 23:32110.85.100.103rfdsggdhgjbfstoutehekex@gmail.com
[ s.t.out.eh.e.k.ex@gmail.com ]
ChinaEvidence
24-Oct-14 23:3236.250.176.99vwelue586tuqugjudnktn3s@gmail.com
[ t.u.qu.g.ju.dnk.t.n3.s@gmail.com ]
ChinaEvidence
24-Oct-14 23:3227.159.198.95ljdwefdsyrobsxmarketingpgjn@gmail.com
[ marketi.n.g.p.g.jn@gmail.com ]
ChinaEvidence
24-Oct-14 23:32200.82.232.137ogwlddknnoopp1015@outlook.comVenezuela 
24-Oct-14 23:3227.159.255.55pasyaeruosdawningrobhcq@gmail.com
[ da.wni.n.g.r.o.b.h.cq@gmail.com ]
ChinaEvidence
24-Oct-14 23:32175.44.4.228ssduwpr86laowpsadisiaqwu1@gmail.com
[ l.a.owp.sa.d.i.sia.qwu1@gmail.com ]
ChinaEvidence
24-Oct-14 23:32125.86.7.5Coppylyqbtc@gmail.comChinaEvidence
24-Oct-14 23:3237.48.80.173YFkarolineglantscosg@yahoo.comNetherlandsEvidence
24-Oct-14 23:32117.26.116.56nike shox us 14ytutyutuy@gmail.comChina 
24-Oct-14 23:32110.80.62.103cpmrctuhefgymnasticyiil@gmail.com
[ gymnasticyiil+qqdglc@gmail.com ]
ChinaEvidence
24-Oct-14 23:3227.150.239.201pasyaeriplcampaigncomp@gmail.com
[ c.a.mpa.i.gn.com.p@gmail.com ]
ChinaEvidence
24-Oct-14 23:32120.37.234.166ljdwefdsyroeggopponentdfiw@gmail.com
[ op.ponen.t.dfi.w@gmail.com ]
China 
24-Oct-14 23:32110.89.12.187fyrtyhdf5zgfurguyert@126.comChinaEvidence
24-Oct-14 23:32188.165.196.77evegecibesooiumofufav@timgmail.comFranceEvidence
24-Oct-14 23:32178.137.166.170azjifaejegoyoudfipo@sonyymail.comUkraineEvidence
24-Oct-14 23:3291.200.12.24NeagoNaxLaxguelphugo@gmail.comUkraine 
Legend
toxic Toxic IP address or "bad" email domain
Highlighted Hot IP or disposable email address