Welcome

We provide lists of spammers that persist in abusing forums and blogs with their scams, ripoffs, exploits and other annoyances*. We provide these lists so that you don't have to endure the never ending job of having to moderate, filter and delete their rubbish.

We provide a "free for use" site where you can check registrations and posts against our database. We list known forum and blog spammers, including IP and email addresses, usernames, how busy they are and, in some cases, evidence of their spam.

There are two ways that you can access this information, either by searching or by using the API provided to automate the searches. The API will allow your site (via a "mod" or plugin) to then make decisions about how you wish to handle the activities of spammers.

Please feel free to use our forum to discuss ways to detect and prevent spam.

Most Recent Submissions

Below are the most recent 200 submissions to our database.

Date IP Address Username Email Location Evidence
22-Oct-14 03:0146.0.57.167AshBrielsleonid340i@gmail.comRussian FederationEvidence
22-Oct-14 03:0127.159.213.204財布 メンズ 人気tsatohmktp@gmail.comChina 
22-Oct-14 03:0136.248.187.125fsshh08d90jjdngksingl93jg900s@gmail.com
[ jjdng.ksi.ngl93.jg900s@gmail.com ]
China 
22-Oct-14 03:01220.161.169.110pacdffgsvdrzxyindenturerknr@gmail.com
[ in.de.n.t.u.r.er.knr@gmail.com ]
ChinaEvidence
22-Oct-14 03:01198.27.65.85Williamwepwilliamonyo@mulberrybagsoutletonlineuk.comCanada 
22-Oct-14 03:01192.241.108.148charlenekirchnerbowiehoshida7710@yahoo.comCanada 
22-Oct-14 03:0136.248.187.125haage1747rjjdngksingl93jg900s@gmail.com
[ j.jdn.gksi.ngl93.jg900s@gmail.com ]
China 
22-Oct-14 03:0137.57.231.125AbizyaloHotkisorjeronimo@gmail.comUkraineEvidence
22-Oct-14 03:0136.248.187.125fsshh71p04jjdngksingl93jg900s@gmail.com
[ j.j.dn.g.ks.i.ngl93.jg900s@gmail.com ]
China 
22-Oct-14 03:0136.248.187.125fsshu41e62jjdngksingl93jg900s@gmail.com
[ jjdngk.s.ingl93.jg900s@gmail.com ]
China 
22-Oct-14 03:0137.57.200.174Jefferyjeltkeldron.tjalf@ufrbox.netUkraine 
22-Oct-14 03:01149.255.255.250GeorgeIrotnnqaib@easyblogs.bizIraq 
22-Oct-14 03:01117.26.249.65GgMICqbueCwhereasryktgt@gmail.com
[ w.h.ereasr.y.k.tgt@gmail.com ]
ChinaEvidence
22-Oct-14 03:0123.254.108.200SuperBasebasesuper@yahoo.com 
22-Oct-14 03:01120.37.235.154rdgdgdhgmfsbeyondaqzgga@gmail.com
[ beyon.daq.z.gga@gmail.com ]
China 
22-Oct-14 03:0176.164.224.141GeorgeIrotnnqaib@easyblogs.bizUnited States 
22-Oct-14 03:01192.198.121.135ulrichcollicottbowiehoshida7710@yahoo.comCanada 
22-Oct-14 03:01110.85.102.4mnghgvvvcportioniluoig@gmail.com
[ p.o.r.t.i.on.i.luo.i.g@gmail.com ]
China 
22-Oct-14 03:0146.118.121.75Phyllisrinyphylis94zi@gmail.comUkraineEvidence
22-Oct-14 03:01196.201.217.49ZKlonacpoklopac90@yahoo.comKenyaEvidence
22-Oct-14 03:0176.164.203.90Adedyupdadsmiefengkuangniubiuk13@gmail.com
[ m.i.e.fen.gk.u.an.gni.ubi..u.k13@gmail.com ]
United States 
22-Oct-14 03:01183.224.1.55dupcvbak]corymbdwnw@hotmail.comChina 
22-Oct-14 03:0189.209.82.209Leraslurlzugsdysopa1973@freemoney.pwUkraine 
22-Oct-14 03:0162.210.114.49LTennantwildvisility@yahoo.comFrance 
22-Oct-14 03:01140.206.204.43alYoshaqalakpopira@mail.ruChinaEvidence
22-Oct-14 03:01121.229.164.78amandasdg@163.comChina 
22-Oct-14 03:0127.159.220.225ucjcyqzeqochangzhongzd862@126.comChina 
22-Oct-14 03:01110.89.53.195ffcxsdhdqkmsewagequzda@gmail.com
[ sew.ag.e.qu.zd.a@gmail.com ]
China 
22-Oct-14 03:0159.58.159.246louis vuitton card holderfvghfyfgguy@gmail.comChina 
22-Oct-14 03:01222.77.226.207416wnuii1conjoinwdvts@gmail.com
[ c.onj.oin.wd.v.t.s@gmail.com ]
ChinaEvidence
22-Oct-14 03:01120.37.234.9rfxcvcgdhgxecsewagequzda@gmail.com
[ sew.a.g.e.q.uz.d.a@gmail.com ]
ChinaEvidence
22-Oct-14 03:0137.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
22-Oct-14 03:0127.159.196.176meledy2grshieldingoynru@gmail.com
[ shield.ing.oynr.u@gmail.com ]
China 
22-Oct-14 03:01176.31.122.130unagaqusuuvamuve@erermail.comFranceEvidence
22-Oct-14 03:01193.201.224.81FrancesGakyourmail@gmail.comUkraine 
22-Oct-14 03:01120.33.216.250dupcvbak]corymbdwnw@hotmail.comChina 
22-Oct-14 03:01120.37.235.49kfgfdhdjdxtransposemivnm@gmail.com
[ tr.an.s.pos.e.m.i.v.nm@gmail.com ]
ChinaEvidence
22-Oct-14 03:0127.153.204.14P6G5M3U80dsgvg1dfgb@gmail.com
[ d.sgv.g.1.dfg.b@gmail.com ]
ChinaEvidence
22-Oct-14 03:0127.159.211.116yfghgffsagyfwjmodestlyfettlk@gmail.com
[ m.od.e.st.l.y.fe.t.t.lk@gmail.com ]
ChinaEvidence
22-Oct-14 03:01110.89.53.94ljdedseyroihireleasevdqr@gmail.com
[ re.leas.evdq.r@gmail.com ]
ChinaEvidence
22-Oct-14 03:015.254.144.36JXphillidadalleorevogz@yahoo.comSwedenEvidence
22-Oct-14 03:01110.89.53.94pasyaerxnmreleasevdqr@gmail.com
[ r.e.l.ea.se.vdqr@gmail.com ]
ChinaEvidence
22-Oct-14 03:01110.85.103.238ljdwefdsyroqllopponentdfiw@gmail.com
[ op.p.o.ne.n.tdfiw@gmail.com ]
China 
22-Oct-14 03:01199.15.233.169Breendajxxvcbeyourselffor@gmail.comUnited StatesEvidence
22-Oct-14 03:01110.89.53.195rfxcvcgdhgpzysewagequzda@gmail.com
[ s.ewa.g.equ.zda@gmail.com ]
ChinaEvidence
22-Oct-14 03:01120.37.234.206pndoarmecsymbolgnayi@gmail.com
[ s.ym.bo.lg.n.a.y.i@gmail.com ]
China 
22-Oct-14 03:01120.37.235.92rfxcvcgdhghjybiologicalffknz@gmail.com
[ biolog.i.c.a.l.f.f.kn.z@gmail.com ]
ChinaEvidence
22-Oct-14 03:01110.89.53.195rfxcvcgdhgsoysewagequzda@gmail.com
[ s.ewa.g.e.qu.z.da@gmail.com ]
ChinaEvidence
22-Oct-14 03:0127.150.239.81Ricpapwjcnsnorkarats@hotmail.comChina 
22-Oct-14 03:0127.18.72.16BernardKipxiyangyang1124@hotmail.comChinaEvidence
22-Oct-14 03:01120.37.235.154rdgdgdhgbjkghosttcrqu@gmail.com
[ gh.ost.tcrq.u@gmail.com ]
ChinaEvidence
22-Oct-14 03:01120.43.27.191rfdsggdhgdmtinstallukkqr@gmail.com
[ i.n.st.all.u.kkqr@gmail.com ]
ChinaEvidence
22-Oct-14 03:01109.168.250.16Anaronfumgtwilliam@yandex.comRussian FederationEvidence
22-Oct-14 03:01110.86.186.191burnecrfghburnetvata@hotmail.comChinaEvidence
22-Oct-14 03:0127.159.220.225zcnosshtckkanmohw602@126.comChina 
22-Oct-14 03:0127.18.72.16Douglasbowxiyangyang1121@hotmail.comChina 
22-Oct-14 03:0127.153.229.244ljdwefdsyroentrawhidetfhe@gmail.com
[ r.a.whi.det.f.h.e@gmail.com ]
ChinaEvidence
22-Oct-14 03:0191.207.6.58tazyviatmr677261124@gmail.comUkraineEvidence
22-Oct-14 03:01178.137.160.199ihozurobeudauxoxom@eehfmail.orgUkraineEvidence
22-Oct-14 03:0027.159.203.60shli70u261429321dh@daditrade.comChinaEvidence
22-Oct-14 03:00121.205.249.73dqxnyhhopcpreptarelomag@gmail.com
[ pre.p.t.a.r.e.lomag@gmail.com ]
ChinaEvidence
22-Oct-14 03:0094.23.251.168esahizeikeoyiopu@gmaieredd.comFranceEvidence
22-Oct-14 03:00159.224.160.202MichaelPiamul.aila@ufrbox.netUkraine 
22-Oct-14 03:00120.37.235.154fdsgdhdmnfghosttcrqu@gmail.com
[ g.h.o.sttc.r.q.u@gmail.com ]
ChinaEvidence
22-Oct-14 03:00110.89.27.29pasyaerbmzappointjmxwno@gmail.com
[ ap.po.int.jm.x.wn.o@gmail.com ]
ChinaEvidence
22-Oct-14 03:00142.4.215.59ThomasMemsthomastipter@pankujvats.comCanada 
22-Oct-14 03:0023.102.165.162L7613aliciaclay0@hotmail.comUnited States 
22-Oct-14 03:0093.118.73.102collettecareydvykqhfrancisreid240@nokiamail.comRomania 
22-Oct-14 03:00202.57.38.166UZpannierpoly@hotmail.comPhilippines 
22-Oct-14 03:0046.118.113.142akuxiwoekuedurobzir@popmailset.comUkraineEvidence
22-Oct-14 03:0046.105.96.219ohilaxeihoredoj@gmail.comFranceEvidence
22-Oct-14 03:0014.110.176.182Agivactksousrvq@blogshoponline.comChinaEvidence
22-Oct-14 03:0027.153.229.244pacdffgsvdrydvrawhidetfhe@gmail.com
[ r.aw.hi.detfhe@gmail.com ]
ChinaEvidence
22-Oct-14 03:00117.26.192.131VermAbireibivense@hotmail.comChinaEvidence
22-Oct-14 03:0091.207.4.201tererrtinCor5543le34@mail.ruUkraine 
22-Oct-14 03:00120.37.235.92rfxcvcgdhgrtzbiologicalffknz@gmail.com
[ b.io.l.og.i.cal.ffkn.z@gmail.com ]
ChinaEvidence
22-Oct-14 03:00121.225.206.169qmlobuaajianzang63576@163.comChinaEvidence
22-Oct-14 03:0063.141.244.250fredricvansteenburgtrhpaullcmxr@outlook.comUnited StatesEvidence
22-Oct-14 03:00110.89.27.68ljdwefdsyrowpomarketingpgjn@gmail.com
[ ma.rke.tin.gpgjn@gmail.com ]
China 
22-Oct-14 03:00134.249.67.63WOWTreadlyruwowdat@yandex.comUkraineEvidence
22-Oct-14 03:00120.37.235.92rfxcvcgdhgjbkbiologicalffknz@gmail.com
[ b.i.ol.og.ic.alff.kn.z@gmail.com ]
ChinaEvidence
22-Oct-14 03:00110.89.53.94ljdedseyroospreleasevdqr@gmail.com
[ r.e.l.e.a.s.e.v.d.q.r@gmail.com ]
ChinaEvidence
22-Oct-14 03:0037.57.231.125AbizyaloHotkisorjeronimo@gmail.comUkraineEvidence
22-Oct-14 03:00140.237.39.198pacdffgsvdrsceinstructqfho@gmail.com
[ i.ns.tr.uc.tqfh.o@gmail.com ]
ChinaEvidence
22-Oct-14 03:00183.224.1.12ivanguinle46ipetrievrkn@live.comChina 
22-Oct-14 03:00140.237.39.198pacdffgsvdracwinstructqfho@gmail.com
[ inst.ruc.t.q.f.h.o@gmail.com ]
China 
22-Oct-14 03:00199.15.233.169Amelianrsbeyourselffor@gmail.comUnited StatesEvidence
22-Oct-14 03:00120.43.30.98vhgdvbjrsaagentrralpy@gmail.com
[ agent.rra.l.py@gmail.com ]
ChinaEvidence
22-Oct-14 03:0027.153.230.217lddshgffdolivacceleratetwxtpi@gmail.com
[ acc.ele.ra.te.t.wx.tpi@gmail.com ]
China 
22-Oct-14 03:00110.89.53.94pasyaerlzareleasevdqr@gmail.com
[ r.ele.ase.v.dqr@gmail.com ]
ChinaEvidence
22-Oct-14 03:00220.161.169.110pacdffgsvdrzxyindenturerknr@gmail.com
[ in.de.n.t.u.r.er.knr@gmail.com ]
China 
22-Oct-14 03:00120.43.30.98nbvfctredyntkagentrralpy@gmail.com
[ a.ge.ntrralpy@gmail.com ]
ChinaEvidence
22-Oct-14 03:00120.37.235.154rdgdgdhgrvcghosttcrqu@gmail.com
[ gh.osttc.rqu@gmail.com ]
ChinaEvidence
22-Oct-14 03:00122.143.3.71NJkncatherineewen@spambog.ruChina 
22-Oct-14 03:0046.105.122.57bvelesyyandxta9499ociviqind@neremail.comFrance 
22-Oct-14 03:00140.237.14.49Rafaelcypereelectionryudx@gmail.comChina 
22-Oct-14 03:0063.141.244.250ivanguinle46ipetrievrkn@live.comUnited States 
22-Oct-14 03:00223.240.139.231accinkfoovalh3438916@hotmail.comChinaEvidence
22-Oct-14 03:00159.224.160.143Williamknfeliciano909@gmail.comUkraineEvidence
22-Oct-14 03:0046.105.122.57bolgaujry809egikla@emailmysr.comFrance 
22-Oct-14 03:0027.153.229.70arreseduthallmarkhpxk@gmail.com
[ h.a.l.lm.a.rkhpx.k@gmail.com ]
ChinaEvidence
22-Oct-14 03:0046.118.121.75Phyllisrinyphylis94zi@gmail.comUkraineEvidence
22-Oct-14 03:0046.105.122.57bmaximulittley4159ociviqind@neremail.comFrance 
22-Oct-14 03:00220.161.169.110ljdwefdsyroxxpindenturerknr@gmail.com
[ in.d.e.ntu.r.e.rknr@gmail.com ]
China 
22-Oct-14 03:0046.105.122.57abobbygooget4807egikla@emailmysr.comFrance 
22-Oct-14 03:0037.239.46.18barobertosmarleyy7729ifaluu@easyblogs.bizIraq 
22-Oct-14 03:00120.37.235.154fdsgdhdocoghosttcrqu@gmail.com
[ ghos.ttc.rqu@gmail.com ]
ChinaEvidence
22-Oct-14 03:00140.237.39.195ljdwefdsyrodzjrescueuilc@gmail.com
[ re.s.c.u.e.u.il.c@gmail.com ]
China 
22-Oct-14 03:0046.105.122.57milesqtivanov2419abuyzamoe@erreemail.comFrance 
22-Oct-14 03:0046.105.122.57aangelatop5729ociviqind@neremail.comFrance 
22-Oct-14 03:0027.154.79.60ycjwjri7xnfdfdjsnfho@gmail.comChina 
22-Oct-14 03:0046.105.122.57agregoasmaarley4080egikla@emailmysr.comFrance 
22-Oct-14 03:00107.150.59.178modestaboldtvpztmcomariexi@yahoo.com 
22-Oct-14 03:00120.37.235.92ffcxsdhdjhdbiologicalffknz@gmail.com
[ b.i.o.l.og.icalf.f.knz@gmail.com ]
ChinaEvidence
22-Oct-14 03:00110.89.27.68ljdwefdsyropugmarketingpgjn@gmail.com
[ marke.t.i.ngpg.jn@gmail.com ]
ChinaEvidence
22-Oct-14 03:0027.150.211.191dy1j9uatdspawnkqwqms@gmail.com
[ spa.wn.k.q.w.qms@gmail.com ]
China 
22-Oct-14 03:00220.161.169.110ljdwefdsyrokgzindenturerknr@gmail.com
[ i.n.d.e.n.t.u.rer.k.n.r@gmail.com ]
China 
22-Oct-14 03:0027.153.229.244ljdwefdsyroxlhrawhidetfhe@gmail.com
[ r.a.whidetf.h.e@gmail.com ]
ChinaEvidence
22-Oct-14 03:00221.176.14.77cvnnrvoojpgxcvxccvbcvbcvb@outlook.comChina 
22-Oct-14 03:00222.79.79.59Bpsejshrezweaponrynupl@gmail.com
[ we.apon.rynu.p.l@gmail.com ]
China 
22-Oct-14 03:00121.225.206.169ľxiangb7300799@163.comChinaEvidence
22-Oct-14 03:0046.105.122.57eveaspetroay3540abuyzamoe@erreemail.comFrance 
22-Oct-14 03:00194.165.30.126aaadvegemlaaadvege@dv-ege.ruRussian Federation 
22-Oct-14 03:00140.237.36.198ljdwefdsyrosuweternaltnas@gmail.com
[ etern.a.lt.n.a.s@gmail.com ]
ChinaEvidence
22-Oct-14 03:0083.6.244.228EWhitwort18@1n.kinefi.plPoland 
22-Oct-14 03:00120.37.234.9rfxcvcgdhgxecsewagequzda@gmail.com
[ sew.a.g.e.q.uz.d.a@gmail.com ]
China 
22-Oct-14 03:0046.105.122.57febudeqeleociviqind@neremail.comFrance 
22-Oct-14 03:00140.237.39.195pacdffgsvdruimrescueuilc@gmail.com
[ r.esc.ue.uil.c@gmail.com ]
ChinaEvidence
22-Oct-14 03:0027.150.211.191hm3l5gndjspawnkqwqms@gmail.com
[ s.pawn.k.q.w.qms@gmail.com ]
China 
22-Oct-14 03:00120.43.25.88ljdwefdsyrodjhconsumerkzybzs@gmail.com
[ c.o.n.s.um.e.rkz.y.bzs@gmail.com ]
China 
22-Oct-14 03:00110.85.102.4liogfchhwthportioniluoig@gmail.com
[ por.ti.o.n.iluoig@gmail.com ]
China 
22-Oct-14 03:00178.45.83.189AshBrielsleonid340i@gmail.comRussian FederationEvidence
22-Oct-14 03:00140.237.39.198pacdffgsvdrzbvinstructqfho@gmail.com
[ i.n.str.u.c.tqf.h.o@gmail.com ]
ChinaEvidence
22-Oct-14 03:0046.105.122.57beveassifty7097abuyzamoe@erreemail.comFrance 
22-Oct-14 03:0046.105.122.57origodqqeloegikla@emailmysr.comFrance 
22-Oct-14 03:0037.239.46.18ZJgoldengamebingo@gmail.comIraq 
22-Oct-14 03:0027.153.231.47pacdffgsvdrlzafeatureuhhv@gmail.com
[ fe.a.t.u.reuhh.v@gmail.com ]
China 
22-Oct-14 03:00121.225.206.169ouerig78jihanp3412@163.comChinaEvidence
22-Oct-14 03:00110.89.53.94ljdedseyroihireleasevdqr@gmail.com
[ r.e.l.easevdqr@gmail.com ]
China 
22-Oct-14 03:00110.85.102.4liogfchhpmzportioniluoig@gmail.com
[ p.or.t.i.o.n.i.luo.ig@gmail.com ]
China 
22-Oct-14 03:0046.105.122.57idwsohutoabuyzamoe@erreemail.comFrance 
22-Oct-14 03:00120.37.234.206pndoarjbvsymbolgnayi@gmail.com
[ symb.o.l.gn.ay.i@gmail.com ]
ChinaEvidence
22-Oct-14 03:00222.77.218.86rqfgdhgpasbuckskinjfjhf@gmail.com
[ b.uck.s.k.i.njfj.hf@gmail.com ]
ChinaEvidence
22-Oct-14 03:0061.241.197.135hcghzrfhmlyswfcr7728@gmail.comChina 
22-Oct-14 03:00222.77.218.86rqfgdhgbqhbuckskinjfjhf@gmail.com
[ buc.k.sk.in.jf.j.h.f@gmail.com ]
China 
22-Oct-14 02:59155.254.35.38charlartbmjekerrkfxdbeggarlyse@hotmail.comUnited States 
22-Oct-14 02:59222.79.79.59Bqbysqdgokweaponrynupl@gmail.com
[ we.a.ponry.n.up.l@gmail.com ]
China 
22-Oct-14 02:5991.236.75.118Michaellotsmichaeltubiq@buymichaelkorsoutletca.caPoland 
22-Oct-14 02:59175.43.121.138xsubmieusbblameejeqsv@gmail.com
[ bl.amee.j.e.qsv@gmail.com ]
China 
22-Oct-14 02:59204.44.82.15VWentwortvanessa.wentworth@netkiff.infoUnited States 
22-Oct-14 02:5986.122.124.11cvnnrvoojpgxcvxccvbcvbcvb@outlook.comRomania 
22-Oct-14 02:59120.33.217.42pasyaermatlongtermuaklbw@gmail.com
[ l.on.gt.er.mua.kl.bw@gmail.com ]
China 
22-Oct-14 02:5937.59.51.128xsubmieusbblameejeqsv@gmail.com
[ bl.amee.j.e.qsv@gmail.com ]
France 
22-Oct-14 02:59120.37.235.92kfgfdhdwsmbiologicalffknz@gmail.com
[ biolog.icalf.fk.nz@gmail.com ]
China 
22-Oct-14 02:5946.105.96.219akixatojcaguheiyoha@gmail.comFranceEvidence
22-Oct-14 02:5937.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
22-Oct-14 02:59120.37.235.125ljdedseyroyjzbaleenudulpk@gmail.com
[ b.a.l.eenudul.p.k@gmail.com ]
ChinaEvidence
22-Oct-14 02:5927.18.72.16BernardKipxiyangyang1124@hotmail.comChinaEvidence
22-Oct-14 02:59193.201.224.40Zllim#ennk[ZgJJjBBjcg,2,4]marketingcywiss@gmail.com
[ ma.r.k.et.i.n.g.cy.w.i.s.s@gmail.com ]
Ukraine 
22-Oct-14 02:5927.153.204.14Pa4OQmplf4dfhusdhfkduc@gmail.com
[ d.fh.u.sd.hfk.d.u.c@gmail.com ]
China 
22-Oct-14 02:5991.207.4.22cvnnrvoojpgxcvxccvbcvbcvb@outlook.comUkraine 
22-Oct-14 02:5991.207.4.201tererrtinCor5543le34@mail.ruUkraine 
22-Oct-14 02:5927.153.228.117ljdedseyroyxvleisuredwra@gmail.com
[ l.eisu.r.edwra@gmail.com ]
ChinaEvidence
22-Oct-14 02:5937.57.231.219HowardLeceortega.sebastian@ufrbox.netUkraineEvidence
22-Oct-14 02:59178.137.160.199itxomiwishejoba@eehfmail.orgUkraineEvidence
22-Oct-14 02:59223.86.22.178GeorgeIrotrewzve@easyblogs.bizChina 
22-Oct-14 02:59195.211.155.143VmHSUnzpuUdrainagelikvad@gmail.com
[ dra.i.na.gelikv.a.d@gmail.com ]
Ukraine 
22-Oct-14 02:59178.137.166.170ayosuraduooceihi@sonyymail.comUkraineEvidence
22-Oct-14 02:59195.211.155.143NbZDZscmuAdrainagelikvad@gmail.com
[ d.r.ain.ag.eli.kv.a.d@gmail.com ]
Ukraine 
22-Oct-14 02:59195.211.155.143CfEZRhaoiOdrainagelikvad@gmail.com
[ draina.g.e.lik.v.ad@gmail.com ]
Ukraine 
22-Oct-14 02:59113.245.119.146ag9nswulcn1sbv6@sina.comChinaEvidence
22-Oct-14 02:59195.211.155.143ZfLWMdqcyXdrainagelikvad@gmail.com
[ d.rain.a.g.eli.kv.a.d@gmail.com ]
Ukraine 
22-Oct-14 02:59195.211.155.143WaKUBgggrHdrainagelikvad@gmail.com
[ d.r.a.in.a.ge.li.kv.ad@gmail.com ]
Ukraine 
22-Oct-14 02:59195.211.155.143JmVRQyfkhRdrainagelikvad@gmail.com
[ dr.a.i.nagel.i.kvad@gmail.com ]
Ukraine 
22-Oct-14 02:59140.237.6.152h70o49fhcommutegydu@gmail.com
[ c.om.mu.te.g.ydu@gmail.com ]
ChinaEvidence
22-Oct-14 02:595.79.189.75dimasic-Erdimasic-dupt@mail.ruRussian Federation 
22-Oct-14 02:595.135.114.145JTrowbridobscenecontainey7me@nokiamail.comFrance 
22-Oct-14 02:59110.89.27.68pacdffgsvdrrggmarketingpgjn@gmail.com
[ ma.rket.in.gpg.j.n@gmail.com ]
China 
22-Oct-14 02:5927.159.202.59pasyaerwgzcontendergizp@gmail.com
[ c.ontend.e.rgi.z.p@gmail.com ]
ChinaEvidence
22-Oct-14 02:59193.201.224.81JosephTUHyourmail@gmail.comUkraine 
22-Oct-14 02:5976.164.224.141GeorgeIrotrewzve@easyblogs.bizUnited States 
22-Oct-14 02:59126.114.182.2036e3qdygebgiqwerazbnh7963586@gmail.com
[ qw.eraz.b.n.h7963586@gmail.com ]
Japan 
22-Oct-14 02:5946.118.113.142onedanihalohotovuku@popmailset.comUkraineEvidence
22-Oct-14 02:59199.15.233.187Evangelinfpqbeyourselffor@gmail.comUnited StatesEvidence
22-Oct-14 02:59198.27.65.193KennethPalkennethnugic@mulberrybagsgroup.usCanada 
22-Oct-14 02:59120.37.234.206ljseyroakesymbolgnayi@gmail.com
[ symbo.l.gn.a.y.i@gmail.com ]
ChinaEvidence
22-Oct-14 02:5980.72.35.84NQwhal577363@agar.co.plPoland 
22-Oct-14 02:59117.30.35.121bobbyparr50restrictroid@gmail.com
[ re.s.tr.ict.r.o.id@gmail.com ]
China 
22-Oct-14 02:5946.105.96.219exoinixikikeasuqeyi@gmail.comFranceEvidence
22-Oct-14 02:59111.126.200.82fasgshtnescxfashezon@zencart-web.comChina 
22-Oct-14 02:59186.95.66.61LesterDenistehly124cuc@hotmail.comVenezuela 
22-Oct-14 02:59120.37.235.49rfxcvcgdhggcjtransposemivnm@gmail.com
[ t.r.ans.pos.e.miv.n.m@gmail.com ]
ChinaEvidence
22-Oct-14 02:59117.30.35.121tommybell82restrictroid@gmail.com
[ re.s.t.r.i.c.tr.o.i.d@gmail.com ]
China 
22-Oct-14 02:5923.88.106.155JMcguireibbyplumb2808@yahoo.comUnited States 
22-Oct-14 02:59126.114.182.2035j3lddgetgeqwerazbnh7963586@gmail.com
[ q.w.eraz.b.n.h7963586@gmail.com ]
Japan 
22-Oct-14 02:59194.165.30.126aaadvegemlaaadvege@dv-ege.ruRussian Federation 
22-Oct-14 02:59113.245.119.146gz6jbpweph0eil3@sina.comChinaEvidence
22-Oct-14 02:5982.102.24.33LesterDenistehly124cuc@hotmail.comPortugal 
22-Oct-14 02:59120.43.30.98lnnvdebhoyhragentrralpy@gmail.com
[ a.ge.ntrr.al.py@gmail.com ]
China 
22-Oct-14 02:59110.85.127.48ybbfedstntliyongyifx800@126.comChina 
22-Oct-14 02:59126.114.182.203alwraqm0qwerazbnh7963586@gmail.com
[ qwe.raz.b.n.h7963586@gmail.com ]
Japan 
22-Oct-14 02:59195.211.154.175jackcdufcgzcteyrojghfgfgdf@gmail.comUkraine 
22-Oct-14 02:5936.248.167.22ksiolrfiu8wolaidaozhelishibu@gmail.com
[ wol.a.i.d.aoz.he.l.i.shibu@gmail.com ]
ChinaEvidence
22-Oct-14 02:59110.85.102.4ghfvhjoxdmportioniluoig@gmail.com
[ por.t.io.n.ilu.o.ig@gmail.com ]
China 
22-Oct-14 02:59199.15.233.173Helenokbbeyourselffor@gmail.comUnited StatesEvidence
22-Oct-14 02:59220.161.169.110ljdwefdsyrojpzindenturerknr@gmail.com
[ i.n.de.ntur.e.r.kn.r@gmail.com ]
ChinaEvidence
22-Oct-14 02:59110.85.103.238ljdwefdsyrohlhopponentdfiw@gmail.com
[ o.p.p.on.e.n.t.df.iw@gmail.com ]
ChinaEvidence
22-Oct-14 02:59194.165.30.126aaadvegesotaaadvege@dv-ege.ruRussian Federation 
22-Oct-14 02:5946.105.96.219igolukotivepficesik@gmail.comFranceEvidence
22-Oct-14 02:59178.137.166.170udagodfuaqqenuuso@sonyymail.comUkraineEvidence
22-Oct-14 02:59149.255.255.250GShowaltediscountpqqcw@gmail.com
[ disco.u.n.tp.qq.cw@gmail.com ]
Iraq 
22-Oct-14 02:59110.89.53.94pasyaerdefreleasevdqr@gmail.com
[ rel.e.a.se.v.d.q.r@gmail.com ]
ChinaEvidence
22-Oct-14 02:59120.37.238.67Pasyaerljpcampaigncomp@gmail.com
[ c.a.mpa.ign.com.p@gmail.com ]
China 
22-Oct-14 02:5927.153.211.137POJDslummygsvxn@yahoo.comChina 
22-Oct-14 02:59120.43.27.191fdsgdhdfjhinstallukkqr@gmail.com
[ ins.t.all.u.k.kqr@gmail.com ]
ChinaEvidence
22-Oct-14 02:58220.161.169.110pacdffgsvdrcayindenturerknr@gmail.com
[ indenturerk.n.r@gmail.com ]
ChinaEvidence
22-Oct-14 02:58120.37.235.92kfgfdhdxelbiologicalffknz@gmail.com
[ bi.o.l.o.g.ic.a.lff.kn.z@gmail.com ]
ChinaEvidence
22-Oct-14 02:58107.183.140.106Gracexpsoworkyxmka@gmail.com 
22-Oct-14 02:5889.209.82.209Leraroamyzugsdysopa1973@freemoney.pwUkraine 
22-Oct-14 02:58175.44.6.108sbgutbjlservicd1576@gmail.com
[ se.r.vi.cd157.6@gmail.com ]
ChinaEvidence
22-Oct-14 02:5827.153.230.217sdgfggyezacceleratetwxtpi@gmail.com
[ a.ccel.e.ra.te.t.w.xtp.i@gmail.com ]
ChinaEvidence
22-Oct-14 02:5827.153.229.244ljdwefdsyrocuirawhidetfhe@gmail.com
[ raw.h.ide.t.fhe@gmail.com ]
ChinaEvidence
22-Oct-14 02:58120.37.238.195pacdffgsvdrrggeerilympkf@gmail.com
[ ee.r.il.ym.p.kf@gmail.com ]
ChinaEvidence
22-Oct-14 02:58199.15.233.169Helenlombeyourselffor@gmail.comUnited States 
22-Oct-14 02:5862.210.178.161S42Uhorriblegiant16uoj3b@bk.ruFrance 
22-Oct-14 02:58110.85.102.4liogfchhdgbportioniluoig@gmail.com
[ po.rti.o.niluoi.g@gmail.com ]
ChinaEvidence
22-Oct-14 02:58212.83.160.236LMcfallundesirablelega8o@inbox.ruFrance 
22-Oct-14 02:58120.37.235.49ffcxsdhdcpptransposemivnm@gmail.com
[ t.r.a.n.spo.s.e.m.i.vn.m@gmail.com ]
ChinaEvidence
22-Oct-14 02:58120.37.234.9rfxcvcgdhggaysewagequzda@gmail.com
[ se.wa.gequzd.a@gmail.com ]
ChinaEvidence
22-Oct-14 02:5814.110.176.182Muckayborelpzxf@golfnewsonlinejp.comChinaEvidence
22-Oct-14 02:5823.88.101.20julissagarretsonbowiehoshida7710@yahoo.comUnited States 
22-Oct-14 02:5862.210.114.9BTretakequ@outlook.comFrance 
22-Oct-14 02:5827.153.230.217kffhfggdnvlacceleratetwxtpi@gmail.com
[ a.c.c.e.le.r.at.e.t.wxtpi@gmail.com ]
ChinaEvidence
22-Oct-14 02:58110.89.53.94pasyaerjoireleasevdqr@gmail.com
[ re.l.e.a.s.ev.d.qr@gmail.com ]
China 
22-Oct-14 02:58120.43.27.191rfdsggdhgrhzinstallukkqr@gmail.com
[ i.n.sta.ll.u.kk.q.r@gmail.com ]
ChinaEvidence
22-Oct-14 02:5827.159.213.144ltrgffdosudsegmentvvmihv@gmail.com
[ se.gm.e.n.t.v.v.m.i.hv@gmail.com ]
China 
22-Oct-14 02:5846.0.57.167AshBrielsleonid340i@gmail.comRussian FederationEvidence
22-Oct-14 02:5827.153.228.117ljdedseyroadaleisuredwra@gmail.com
[ l.e.is.u.r.e.dw.ra@gmail.com ]
ChinaEvidence
22-Oct-14 02:58110.89.53.94ljdedseyroutcreleasevdqr@gmail.com
[ r.e.l.ea.sevd.qr@gmail.com ]
ChinaEvidence
22-Oct-14 02:5846.105.96.219ducozonixojipur@gmail.comFrance 
22-Oct-14 02:58218.75.155.242UXrafalkocinski3106@gmail.com
[ r.a.falkoc.inski3106@gmail.com ]
ChinaEvidence
22-Oct-14 02:5827.153.229.244pacdffgsvdrysirawhidetfhe@gmail.com
[ ra.whi.de.t.f.h.e@gmail.com ]
ChinaEvidence
22-Oct-14 02:58220.161.169.110ljdwefdsyrockiindenturerknr@gmail.com
[ inde.n.t.ur.e.rknr@gmail.com ]
ChinaEvidence
22-Oct-14 02:58223.86.22.178patrickmtexaxd7333hakott@easyblogs.bizChina 
22-Oct-14 02:58120.37.238.228ljdwefdsyrojerpurplehcjh@gmail.com
[ pur.plehc.j.h@gmail.com ]
ChinaEvidence
22-Oct-14 02:58183.207.228.12IIpedro_clutter@freexms.comChina 
22-Oct-14 02:58110.89.27.29ljdedseyrotbcappointjmxwno@gmail.com
[ appo.i.ntj.m.xw.no@gmail.com ]
China 
22-Oct-14 02:58107.150.52.42PKXFlaiuzhiwin@yahoo.com 
22-Oct-14 02:5891.207.4.201tererrtinCor5543le34@mail.ruUkraine 
22-Oct-14 02:5837.239.46.10Ameliajjwbeyourselffor@gmail.comIraq 
22-Oct-14 02:58199.15.233.167Ameliajjwbeyourselffor@gmail.comUnited States 
22-Oct-14 02:58192.241.108.162robertakindeldazcpnbowiehoshida7710@yahoo.comCanada 
22-Oct-14 02:58199.15.233.187Evangelinaevbeyourselffor@gmail.comUnited States 
22-Oct-14 02:58117.26.79.28k93q29detectonicgylf@gmail.com
[ tect.o.n.i.cg.ylf@gmail.com ]
ChinaEvidence
22-Oct-14 02:5827.150.242.152c3064gnscrudelyxirt@gmail.com
[ cru.de.l.y.xirt@gmail.com ]
ChinaEvidence
22-Oct-14 02:5827.159.20.185Bqgiihmaoatwotoedmkro@gmail.com
[ tw.o.toed.m.kr.o@gmail.com ]
ChinaEvidence
22-Oct-14 02:58194.165.30.126aaadvegemlaaadvege@dv-ege.ruRussian Federation 
22-Oct-14 02:58120.43.5.154aclinena853countherp1983@gmail.com
[ cou.nthe.rp1983@gmail.com ]
ChinaEvidence
22-Oct-14 02:5846.105.96.219edusekibecuxoq@gmail.comFrance 
22-Oct-14 02:58120.203.215.11Gisellegwwbeyourselffor@gmail.comChina 
22-Oct-14 02:58199.15.233.167Gisellegwwbeyourselffor@gmail.comUnited States 
22-Oct-14 02:58110.89.46.2305175yina88greetingspmaip@gmail.com
[ g.r.e.etin.gsp.m.a.ip@gmail.com ]
ChinaEvidence
22-Oct-14 02:58198.245.51.118SVKPrcellisoe@yahoo.co.ukCanada 
22-Oct-14 02:58198.245.51.118SVKPrcellisoe@yahoo.co.ukCanada 
22-Oct-14 02:58110.89.46.2307156ytju74greetingspmaip@gmail.com
[ g.re.eti.ng.spmaip@gmail.com ]
ChinaEvidence
22-Oct-14 02:5827.159.20.185Bkbcpwxpowtwotoedmkro@gmail.com
[ twot.oedmk.ro@gmail.com ]
ChinaEvidence
22-Oct-14 02:58178.45.83.189AshBrielsleonid340i@gmail.comRussian FederationEvidence
22-Oct-14 02:57104.194.26.229キャスキッドソン ランヤードtcpkzfdxcq@gmail.com 
22-Oct-14 02:57193.201.224.18hnmltmdhuqdudgeonhydr@outlook.comUkraine 
22-Oct-14 02:5791.200.12.84Beimecallealiguelphugo@gmail.comUkraine 
22-Oct-14 02:57199.15.233.173Gisellemlkbeyourselffor@gmail.comUnited States 
22-Oct-14 02:5737.239.46.2dizzycgogleta1691eclipsezuuqih@gmail.com
[ eclipsezu.uq.i.h@gmail.com ]
Iraq 
22-Oct-14 02:57175.42.44.161rewy73rl40mlxcenwork@outlet23.comChina 
22-Oct-14 02:5723.94.36.174treygxwdmcwzviypvirgiliowhiddenosx@yahoo.comUnited States 
22-Oct-14 02:5791.236.74.251JPurvesa@atrais-kredits24.comPoland 
22-Oct-14 02:57175.42.91.97tnbileelxxsomething801@hotmail.comChina 
22-Oct-14 02:57104.128.27.132MRoderickmikeroderick@video.adriaticmail.com 
22-Oct-14 02:57120.43.25.88pacdffgsvdrbvtconsumerkzybzs@gmail.com
[ c.on.sum.e.rk.z.y.b.z.s@gmail.com ]
China 
22-Oct-14 02:57186.90.70.251babradatianova4647mrmluv@easyblogs.bizVenezuela 
22-Oct-14 02:57104.128.29.159HTeverettanthony88@smart.feamail.com 
22-Oct-14 02:5727.150.222.199v3397kfalimestoneojmt@gmail.com
[ li.m.e.s.t.oneojmt@gmail.com ]
ChinaEvidence
22-Oct-14 02:57117.26.79.28k93q29detectonicgylf@gmail.com
[ tect.o.n.i.cg.ylf@gmail.com ]
ChinaEvidence
22-Oct-14 02:5791.207.4.201tererrtinCor5543le34@mail.ruUkraine 
22-Oct-14 02:57188.237.185.202JXlikelymilli@hotmail.comMoldova, Republic of 
22-Oct-14 02:57107.153.85.117fawngillesqgznuvirgiliowhiddenosx@yahoo.com 
22-Oct-14 02:5727.159.20.185Bnkzmmsswytwotoedmkro@gmail.com
[ tw.ot.oedm.kr.o@gmail.com ]
ChinaEvidence
22-Oct-14 02:5791.236.74.251C02Qb@atrais-kredits24.comPoland 
22-Oct-14 02:57140.237.36.198ljdwefdsyroldneternaltnas@gmail.com
[ et.ern.a.l.t.nas@gmail.com ]
China 
22-Oct-14 02:57175.44.6.4svbjcos52laowiusdaheghjsa@gmail.com
[ lao.w.iu.sd.ahe.g.hjsa@gmail.com ]
ChinaEvidence
22-Oct-14 02:5727.153.163.248839qwzhu4barrelfulylocju@gmail.com
[ bar.r.e.lfu.lylocju@gmail.com ]
ChinaEvidence
22-Oct-14 02:57194.165.30.126aaadvegemlaaadvege@dv-ege.ruRussian Federation 
22-Oct-14 02:5627.159.220.225zokcebvvukchangzhongzd862@126.comChinaEvidence
22-Oct-14 02:56119.178.139.235WRenteriareiki@only-dance.comChina 
22-Oct-14 02:5646.0.57.167AshBrielsleonid340i@gmail.comRussian FederationEvidence
22-Oct-14 02:5627.153.228.117pasyaeraygleisuredwra@gmail.com
[ lei.su.re.d.wra@gmail.com ]
China 
22-Oct-14 02:56195.225.118.56B7097numberlessveget6v@yahoo.comSwitzerland 
22-Oct-14 02:5676.164.224.141GeorgeIrothlnryi@easyblogs.bizUnited States 
22-Oct-14 02:56172.246.249.10murrayspauldingbowiehoshida7710@yahoo.comUnited States 
22-Oct-14 02:5623.232.160.12corneliushollinworthbowiehoshida7710@yahoo.com 
22-Oct-14 02:5695.69.241.116CharlesSelmseiognouds@mailontherail.netUkraineEvidence
22-Oct-14 02:56167.114.53.68SVYCterrepulmo1988@yahoo.comUnited States 
22-Oct-14 02:56192.69.253.29willaplumbcqiyesotgtbowiehoshida7710@yahoo.comUnited States 
22-Oct-14 02:56113.161.71.30JYellanrajaratnam@outlook.comViet Nam 
22-Oct-14 02:56120.33.217.42ljdedseyrofqllongtermuaklbw@gmail.com
[ l.o.ng.t.e.rm.u.aklbw@gmail.com ]
China 
22-Oct-14 02:56195.154.64.214sylviaml60dolorests69@deannakacie.inxes.inFrance 
22-Oct-14 02:5627.150.197.194kiaxatmpilaowiusdaheghjsa@gmail.com
[ l.ao.wiusd.a.h.eg.hjsa@gmail.com ]
ChinaEvidence
22-Oct-14 02:5627.153.231.47pacdffgsvdrwnxfeatureuhhv@gmail.com
[ f.eat.u.re.uh.h.v@gmail.com ]
China 
22-Oct-14 02:56120.37.235.49rqfgdhgwuntransposemivnm@gmail.com
[ tr.ans.p.ose.m.i.v.n.m@gmail.com ]
China 
22-Oct-14 02:5662.210.97.80SSchumachunifilarverb@yahoo.comFrance 
22-Oct-14 02:56196.201.217.48Samuelknasexy521@gmail.com
[ asex.y5.21@gmail.com ]
Kenya 
22-Oct-14 02:56195.211.155.225pinetwteyrojhnbgedzq@gmail.comUkraine 
22-Oct-14 02:56198.100.149.177OJfcymccormig@yahoo.co.ukCanada 
22-Oct-14 02:56149.255.255.242Ruthie89Fpaunchyvert@hotmail.comIraq 
22-Oct-14 02:5627.159.232.134mj5366806assumptionzlul@gmail.com
[ as.s.um.pt.ionzlul@gmail.com ]
ChinaEvidence
22-Oct-14 02:5691.200.12.94Samuelknasexy521@gmail.com
[ asex.y5.21@gmail.com ]
Ukraine 
22-Oct-14 02:56196.201.217.49CharlesBurolinjunfang@outlook.comKenya 
22-Oct-14 02:56222.79.79.59Blagunkrueweaponrynupl@gmail.com
[ weapo.n.ry.n.upl@gmail.com ]
China 
22-Oct-14 02:56222.79.79.59Byvvgzgfmitwotoedmkro@gmail.com
[ two.t.o.ed.m.kr.o@gmail.com ]
ChinaEvidence
22-Oct-14 02:56140.237.6.152h70o49fhcommutegydu@gmail.com
[ c.om.mu.te.g.ydu@gmail.com ]
ChinaEvidence
22-Oct-14 02:5636.248.167.22ksiolrfiu8wolaidaozhelishibu@gmail.com
[ wol.a.i.d.aoz.he.l.i.shibu@gmail.com ]
ChinaEvidence
22-Oct-14 02:5676.164.224.141GeorgeIrotuavtag@easyblogs.bizUnited States 
22-Oct-14 02:56192.95.23.156HDIOXqlajpdrs@yahoo.comUnited StatesEvidence
22-Oct-14 02:56110.89.46.2300757xaes50greetingspmaip@gmail.com
[ gree.t.i.n.gsp.ma.i.p@gmail.com ]
ChinaEvidence
22-Oct-14 02:56194.165.30.126aaadvegelalkaaadvege@dv-ege.ruRussian Federation 
22-Oct-14 02:5691.207.4.201tererrtinCor5543le34@mail.ruUkraine 
22-Oct-14 02:55178.45.83.189AshBrielsleonid340i@gmail.comRussian FederationEvidence
22-Oct-14 02:55110.89.46.2302721swap47greetingspmaip@gmail.com
[ g.reetin.g.s.p.m.a.ip@gmail.com ]
ChinaEvidence
22-Oct-14 02:55110.89.46.2305175yina88greetingspmaip@gmail.com
[ g.r.e.etin.gsp.m.a.ip@gmail.com ]
ChinaEvidence
22-Oct-14 02:55110.89.46.2308809uyht46greetingspmaip@gmail.com
[ gr.ee.ting.s.pma.i.p@gmail.com ]
ChinaEvidence
22-Oct-14 02:5537.48.80.175LKluisaltwzxhn@outlook.comNetherlands 
22-Oct-14 02:55220.161.169.110pacdffgsvdryryindenturerknr@gmail.com
[ inde.n.tu.rerk.nr@gmail.com ]
ChinaEvidence
22-Oct-14 02:5537.187.144.114Julianbonser@gmail.comFranceEvidence
22-Oct-14 02:55103.244.80.40CharlesBurolinjunfang@outlook.comChina 
22-Oct-14 02:55110.89.46.2307156ytju74greetingspmaip@gmail.com
[ g.re.eti.ng.spmaip@gmail.com ]
ChinaEvidence
22-Oct-14 02:55140.237.39.195pacdffgsvdrvvhrescueuilc@gmail.com
[ re.s.c.u.eu.ilc@gmail.com ]
China 
22-Oct-14 02:55223.86.22.178GeorgeIrotpvtlxr@easyblogs.bizChina 
22-Oct-14 02:55120.43.5.154aclinena033countherp1983@gmail.com
[ cou.nthe.rp1983@gmail.com ]
China 
22-Oct-14 02:55120.43.28.74hauebdoyudererahmiths19608@gmail.com
[ d.er.er.a.h.miths19608@gmail.com ]
ChinaEvidence
22-Oct-14 02:5576.164.224.141GeorgeIrotpvtlxr@easyblogs.bizUnited States 
22-Oct-14 02:5527.150.242.152c3064gnscrudelyxirt@gmail.com
[ cru.de.l.y.xirt@gmail.com ]
ChinaEvidence
22-Oct-14 02:55192.151.158.234wemeddyphadlyvacillatenxrljk@gmail.com
[ v.a.c.i.ll.a.t.enxr.l.jk@gmail.com ]
United States 
22-Oct-14 02:5560.55.42.166CharlesBurolinjunfang@outlook.comChina 
22-Oct-14 02:5593.118.76.55MPlattbethannsanzottauswj@yahoo.comRomania 
22-Oct-14 02:5576.164.226.10njrlwitzzvcrfert5436hd@gmail.comUnited States 
22-Oct-14 02:5576.164.226.10ipylscixuvcrfert5436hd@gmail.comUnited States 
22-Oct-14 02:5527.159.20.185Bbwvpoebgctwotoedmkro@gmail.com
[ t.wotoe.dmk.ro@gmail.com ]
ChinaEvidence
22-Oct-14 02:55110.89.27.68pacdffgsvdrobomarketingpgjn@gmail.com
[ m.a.r.k.et.i.ng.pgjn@gmail.com ]
China 
22-Oct-14 02:5546.0.57.167AshBrielsleonid340i@gmail.comRussian FederationEvidence
22-Oct-14 02:555.196.160.204CharlesTicantiddos.expert@i.uaGermanyEvidence
22-Oct-14 02:5591.207.7.182JosephZepmarie@thehosh.comUkraine 
22-Oct-14 02:55140.206.204.42veesytop5310schlensker699dana@hotmail.comChina 
22-Oct-14 02:55194.165.30.126aaadvegebymnaaadvege@dv-ege.ruRussian Federation 
22-Oct-14 02:5527.159.20.185Bkbcpwxpowtwotoedmkro@gmail.com
[ twot.oedmk.ro@gmail.com ]
ChinaEvidence
22-Oct-14 02:5579.133.204.130freddy6317jqtskcalizaeysawjw@outlook.comPoland 
22-Oct-14 02:5594.249.241.106qthkandicekkeorddaspiringschedulcup53@laposte.netGermany 
22-Oct-14 02:5479.133.204.130kaseyvidaprhoakmbyjializaeysawjw@outlook.comPoland 
22-Oct-14 02:5458.48.137.171tviltiagmariavei04@gugoumail.comChina 
22-Oct-14 02:5491.207.4.201tererrtinFag5543le34@mail.ruUkraine 
22-Oct-14 02:5459.174.165.135nyenwikdmarianom04@gugoumail.comChina 
22-Oct-14 02:54110.86.70.171tybrown52debtorllzg@gmail.com
[ de.btorll.z.g@gmail.com ]
China 
22-Oct-14 02:5427.159.20.185Bqgiihmaoatwotoedmkro@gmail.com
[ tw.o.toed.m.kr.o@gmail.com ]
ChinaEvidence
22-Oct-14 02:54118.97.95.182broertosshulze3151eclipsezuuqih@gmail.com
[ eclip.sezu.u.qi.h@gmail.com ]
Indonesia 
22-Oct-14 02:54222.77.226.207123hydcl6conjoinwdvts@gmail.com
[ co.n.j.oi.nwdvt.s@gmail.com ]
ChinaEvidence
22-Oct-14 02:5479.133.204.130trudiwillshiretivruqalizaeysawjw@outlook.comPoland 
22-Oct-14 02:5427.159.20.185Bkflfyfkwntwotoedmkro@gmail.com
[ t.woto.e.dm.kro@gmail.com ]
ChinaEvidence
22-Oct-14 02:5458.49.237.67flqjymarnolancas03@gugoumail.comChinaEvidence
22-Oct-14 02:5491.207.4.201tererrtinCor5543le34@mail.ruUkraine 
22-Oct-14 02:5479.133.204.130ginapottsnkflszjbnijinbtmnafr@outlook.comPoland 
22-Oct-14 02:5427.159.20.185Byllzowvqutwotoedmkro@gmail.com
[ t.w.otoed.m.k.r.o@gmail.com ]
ChinaEvidence
22-Oct-14 02:5462.210.82.82eacrlroluafirepre@hotmail.comFrance 
22-Oct-14 02:54198.245.51.205AMcCullouuwkeytvccde@yahoo.co.ukCanada 
22-Oct-14 02:54117.26.248.6ljdedseyromaucomedyolwh@gmail.com
[ co.me.dyolw.h@gmail.com ]
China 
22-Oct-14 02:54120.37.234.206ljseyrobwssymbolgnayi@gmail.com
[ s.y.m.b.ol.gn.a.y.i@gmail.com ]
China 
22-Oct-14 02:5468.71.156.156DSteffentefederowicz@hotmail.comUnited States 
22-Oct-14 02:5494.242.255.236bajanssmaarleyy1580dorothyxd5@julie.reilly.katkit.inLuxembourg 
22-Oct-14 02:5494.126.178.1kimberlyvu69deniseiw16@deannakacie.inxes.inDenmark 
22-Oct-14 02:54190.205.199.141arobertosnray579schlensker699dana@hotmail.comVenezuela 
22-Oct-14 02:5491.108.180.120manualdaweqbdxtmqeraguel81foldenihqxi@mail.ruSweden 
22-Oct-14 02:54192.99.150.55EC66neomagww@hotmail.comCanada 
22-Oct-14 02:54199.15.233.169Donnadbbeyourselffor@gmail.comUnited States 
22-Oct-14 02:5478.9.152.43VDrethabuley@6ip.usPoland 
22-Oct-14 02:54222.79.79.59Bdmfgeswdtweaponrynupl@gmail.com
[ w.eap.o.n.r.yn.u.p.l@gmail.com ]
China 
22-Oct-14 02:5496.47.226.20kimberlyvu69deniseiw16@deannakacie.inxes.inAnonymous Proxy 
22-Oct-14 02:54110.89.53.195ffcxsdhdylksewagequzda@gmail.com
[ s.ewa.ge.q.u.z.d.a@gmail.com ]
China 
22-Oct-14 02:5427.153.204.14Wr9LFsddz6dfhusdhfkduc@gmail.com
[ dfhu.s.d.h.f.k.duc@gmail.com ]
China 
22-Oct-14 02:54204.44.85.56Buster04Tyaedangrice7607@mailcatch.comUnited States 
22-Oct-14 02:5427.153.233.231Louis Vuitton N91234hgfjhgghcjkghc@gmail.comChina 
22-Oct-14 02:5427.150.222.199v3397kfalimestoneojmt@gmail.com
[ li.m.e.s.t.oneojmt@gmail.com ]
ChinaEvidence
22-Oct-14 02:5427.159.20.185Bnkzmmsswytwotoedmkro@gmail.com
[ tw.ot.oedm.kr.o@gmail.com ]
ChinaEvidence
22-Oct-14 02:54175.44.6.4svbjcos52laowiusdaheghjsa@gmail.com
[ lao.w.iu.sd.ahe.g.hjsa@gmail.com ]
ChinaEvidence
22-Oct-14 02:5437.57.231.125AbizyaloHotkisorjeronimo@gmail.comUkraineEvidence
22-Oct-14 02:5437.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
22-Oct-14 02:54110.89.53.94pasyaerqdnreleasevdqr@gmail.com
[ r.e.leas.ev.d.qr@gmail.com ]
ChinaEvidence
22-Oct-14 02:5446.22.215.219eulaliaferrierezsgscintillatingga5345@laposte.netEstonia 
22-Oct-14 02:545.135.39.148sebastian4476omchristiemagnandrtb@yahoo.comFrance 
22-Oct-14 02:54198.100.156.94EStovallbrookmccord549@spambog.comUnited States 
22-Oct-14 02:54120.37.234.9kfgfdhddsgsewagequzda@gmail.com
[ sewa.gequ.zda@gmail.com ]
ChinaEvidence
22-Oct-14 02:54134.249.141.83TSzDeLnempty@unknown.comUkraine 
22-Oct-14 02:5427.153.160.151ope457c2sdf5d698e@163.comChina 
22-Oct-14 02:54182.52.42.183NIherbertufgg733@pjmanufacturing.comThailandEvidence
22-Oct-14 02:53197.224.58.94walzewal_2004@netcourrier.comMauritius 
22-Oct-14 02:5327.159.205.46nbiikvow]apteroust@hotmail.comChina 
22-Oct-14 02:5362.210.91.168Diegodeadman@gmail.comFranceEvidence
22-Oct-14 02:53175.44.56.53LBirdmiller12@asopenhrs.comChina 
22-Oct-14 02:53178.45.83.189AshBrielsleonid340i@gmail.comRussian FederationEvidence
22-Oct-14 02:5362.210.97.46WPpaprikaquasi@yahoo.comFranceEvidence
22-Oct-14 02:53192.3.55.58NYtldagnymcmasterhlp@yahoo.comUnited States 
22-Oct-14 02:53175.43.121.138CqPBCciftAeclipsezuuqih@gmail.com
[ ec.l.i.psezu.u.qih@gmail.com ]
China 
22-Oct-14 02:53190.202.247.178pittyswft3404schlensker699dana@hotmail.comVenezuela 
22-Oct-14 02:53110.89.41.173pre owned louis vuittonjhkh@gmail.comChina 
22-Oct-14 02:53194.165.30.126aaadvegeVusaaadvege@dv-ege.ruRussian Federation 
22-Oct-14 02:5327.153.163.248839qwzhu4barrelfulylocju@gmail.com
[ bar.r.e.lfu.lylocju@gmail.com ]
ChinaEvidence
22-Oct-14 02:53195.211.155.138CqPBCciftAeclipsezuuqih@gmail.com
[ ec.l.i.psezu.u.qih@gmail.com ]
Ukraine 
22-Oct-14 02:53120.198.243.35louveniapauyqydlaceychildress@mailcatch.comChina 
22-Oct-14 02:53112.111.165.69fden31vmmgosiengnnslkngl22kjls@gmail.com
[ sieng.nns.lkn.g.l22kjls@gmail.com ]
China 
22-Oct-14 02:5391.207.4.201tererrtinCor5543le34@mail.ruUkraine 
22-Oct-14 02:53112.111.165.69fden80xunzjsiengnnslkngl22kjls@gmail.com
[ s.i.en.gn.ns.lkn.g.l22kjls@gmail.com ]
China 
22-Oct-14 02:53110.89.46.2305175yina88greetingspmaip@gmail.com
[ g.r.e.etin.gsp.m.a.ip@gmail.com ]
ChinaEvidence
22-Oct-14 02:53110.89.46.2302721swap47greetingspmaip@gmail.com
[ g.reetin.g.s.p.m.a.ip@gmail.com ]
ChinaEvidence
22-Oct-14 02:53110.89.46.2300757xaes50greetingspmaip@gmail.com
[ gree.t.i.n.gsp.ma.i.p@gmail.com ]
ChinaEvidence
22-Oct-14 02:53117.26.79.28k93q29detectonicgylf@gmail.com
[ tect.o.n.i.cg.ylf@gmail.com ]
ChinaEvidence
22-Oct-14 02:5327.159.232.134mj5366806assumptionzlul@gmail.com
[ as.s.um.pt.ionzlul@gmail.com ]
ChinaEvidence
22-Oct-14 02:53110.89.46.2308809uyht46greetingspmaip@gmail.com
[ gr.ee.ting.s.pma.i.p@gmail.com ]
ChinaEvidence
22-Oct-14 02:53120.43.28.74hauebdoyudererahmiths19608@gmail.com
[ d.er.er.a.h.miths19608@gmail.com ]
ChinaEvidence
22-Oct-14 02:53110.89.46.2307156ytju74greetingspmaip@gmail.com
[ g.re.eti.ng.spmaip@gmail.com ]
ChinaEvidence
22-Oct-14 02:53120.43.30.98fkjjkfsbrscmagentrralpy@gmail.com
[ age.nt.r.r.a.l.p.y@gmail.com ]
China 
22-Oct-14 02:53195.211.155.138Darrenmowpromotekthix@gmail.com
[ p.romo.te.k.th.ix@gmail.com ]
Ukraine 
22-Oct-14 02:5346.0.57.167AshBrielsleonid340i@gmail.comRussian FederationEvidence
22-Oct-14 02:5394.41.48.114Raymondelraymondlupei@yandex.ruRussian Federation 
22-Oct-14 02:53198.100.149.40AWupicciutorb@yahoo.co.ukCanada 
22-Oct-14 02:53108.177.194.70LWestbroochristynarontlvnf@yahoo.comUnited States 
22-Oct-14 02:53117.175.118.37faithderougemontjaimeseiler7454@mailcatch.comChina 
22-Oct-14 02:53113.161.220.133valerieypcrexgykqicujecuhho0709@mail.ruViet Nam 
22-Oct-14 02:5346.246.39.184Calvinslmeghannoonypfn039@outlook.comSweden 
22-Oct-14 02:53117.135.250.37kylemcclemensypfsnokaylawestacott@mailcatch.comChina 
22-Oct-14 02:5362.210.97.46EUascorbicfact@yahoo.comFranceEvidence
22-Oct-14 02:5327.150.242.152c3064gnscrudelyxirt@gmail.com
[ cru.de.l.y.xirt@gmail.com ]
ChinaEvidence
22-Oct-14 02:53110.89.62.113udxtlftzpkqifengpingfh499@126.comChina 
22-Oct-14 02:5327.159.20.185Bbwvpoebgctwotoedmkro@gmail.com
[ t.wotoe.dmk.ro@gmail.com ]
ChinaEvidence
22-Oct-14 02:5327.159.20.185Bkbcpwxpowtwotoedmkro@gmail.com
[ twot.oedmk.ro@gmail.com ]
ChinaEvidence
22-Oct-14 02:5337.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
22-Oct-14 02:5227.153.229.244pacdffgsvdrxzcrawhidetfhe@gmail.com
[ raw.h.id.et.fh.e@gmail.com ]
China 
22-Oct-14 02:52222.77.226.207123hydcl6conjoinwdvts@gmail.com
[ co.n.j.oi.nwdvt.s@gmail.com ]
ChinaEvidence
22-Oct-14 02:5258.49.237.67flqjymarnolancas03@gugoumail.comChinaEvidence
22-Oct-14 02:5227.159.20.185Byllzowvqutwotoedmkro@gmail.com
[ t.w.otoed.m.k.r.o@gmail.com ]
ChinaEvidence
22-Oct-14 02:52175.42.19.40CWaltertracidechair@discardmail.comChina 
22-Oct-14 02:5227.159.20.185Bkflfyfkwntwotoedmkro@gmail.com
[ t.woto.e.dm.kro@gmail.com ]
ChinaEvidence
22-Oct-14 02:5238.84.70.75KVXOrobertmaier8585@gmail.comUnited States 
22-Oct-14 02:52210.101.131.232sdkpagztntenableure@yahoo.comRepublic of Korea 
22-Oct-14 02:52120.198.243.131XKfloydhacs@hotmail.comChina 
22-Oct-14 02:5261.54.221.200MCoronacaesiumsoph@hotmail.comChina 
22-Oct-14 02:52193.201.224.28cyejazznlfanpjes5g5@hotmail.comUkraine 
22-Oct-14 02:52199.15.233.169Helenotebeyourselffor@gmail.comUnited States 
22-Oct-14 02:5278.138.97.85kristofero08jnrxhzygyuwbar@yahoo.comGermany 
22-Oct-14 02:5261.90.62.149AClelandellamyte@hotmail.comThailand 
22-Oct-14 02:52197.224.58.94walzewal_2004@netcourrier.comMauritius 
22-Oct-14 02:52140.237.39.198pacdffgsvdrbyminstructqfho@gmail.com
[ i.n.stru.ctq.fh.o@gmail.com ]
China 
22-Oct-14 02:52126.19.106.62KUquvdgxagpqxh@sohu.comJapan 
22-Oct-14 02:52140.237.15.170shop authentic louis vuitton m51130ftjf@gmail.comChina 
22-Oct-14 02:52195.211.155.143NuHRQlncgMdrainagelikvad@gmail.com
[ d.r.ai.na.g.e.l.i.k.va.d@gmail.com ]
Ukraine 
22-Oct-14 02:52193.201.224.64Williameaxiejianhuixiexiexiexiexie@gmail.comUkraine 
22-Oct-14 02:52116.228.55.217affolibiohawnxr0301@uggbuystorejp.comChina 
22-Oct-14 02:52198.27.65.85GeorgeRoomgeorgedyncdl@hotmulberrybags2uk.comCanada 
22-Oct-14 02:5227.150.222.199v3397kfalimestoneojmt@gmail.com
[ li.m.e.s.t.oneojmt@gmail.com ]
ChinaEvidence
22-Oct-14 02:52193.201.224.46acjcjydncozzseqj7v9@hotmail.comUkraine 
22-Oct-14 02:52120.43.25.55UqGQMxupcYwhereasryktgt@gmail.com
[ where.a.s.r.y.k.t.gt@gmail.com ]
ChinaEvidence
22-Oct-14 02:5291.200.12.53XfFRRppmfNdrainagelikvad@gmail.com
[ drai.nag.el.i.kv.ad@gmail.com ]
UkraineEvidence
22-Oct-14 02:5246.164.233.195Holfdosseriesclunievov@gmail.comRussian FederationEvidence
22-Oct-14 02:5237.239.46.2Helensbobeyourselffor@gmail.comIraq 
22-Oct-14 02:52175.44.6.4svbjcos52laowiusdaheghjsa@gmail.com
[ lao.w.iu.sd.ahe.g.hjsa@gmail.com ]
ChinaEvidence
22-Oct-14 02:5291.200.12.25MargoLexaferbmargolexa@bigmail.orgUkraineEvidence
22-Oct-14 02:5227.159.20.185Bnkzmmsswytwotoedmkro@gmail.com
[ tw.ot.oedm.kr.o@gmail.com ]
ChinaEvidence
22-Oct-14 02:52120.43.30.179ljdedseyrohnftabulaterzom@gmail.com
[ tab.ula.te.rzom@gmail.com ]
China 
22-Oct-14 02:52126.65.149.199alrxaam3kbhsgbjack9658667@gmail.com
[ kb.h.s.g.b.ja.ck9658667@gmail.com ]
Japan 
22-Oct-14 02:52199.15.233.167Helensbobeyourselffor@gmail.comUnited States 
22-Oct-14 02:5259.174.167.65bmwsfxdudeidrafy03@gugoumail.comChina 
22-Oct-14 02:52126.65.149.199lvwrldmgzkbhsgbjack9658667@gmail.com
[ k.bh.s.g.b.ja.ck9658667@gmail.com ]
Japan 
22-Oct-14 02:52126.65.149.199liwridxgvkbhsgbjack9658667@gmail.com
[ kbh.s.g.b.ja.ck9658667@gmail.com ]
Japan 
22-Oct-14 02:52199.15.233.165Geraldmopgolfingswingis@mail.ruUnited States 
22-Oct-14 02:5227.153.238.38buy Louis Vuitton Insolite Walletsdsss@gmail.comChina 
22-Oct-14 02:52195.154.177.139UFgris@cpafederation.comFrance 
22-Oct-14 02:5227.153.163.248839qwzhu4barrelfulylocju@gmail.com
[ bar.r.e.lfu.lylocju@gmail.com ]
ChinaEvidence
22-Oct-14 02:5262.210.142.7Hannahgreenwood@webtown.comFranceEvidence
22-Oct-14 02:5262.210.142.7Brandonfreelife@yahoo.comFranceEvidence
22-Oct-14 02:52140.206.204.42Charlescypeschlensker699dana@hotmail.comChina 
22-Oct-14 02:52175.42.93.16affolibiohawnxr0301@uggbuystorejp.comChina 
22-Oct-14 02:5287.98.243.70kerrirrrpfkqfanayclemmiedilanslfz@yahoo.comGermany 
22-Oct-14 02:5227.153.136.112cheap jordan shoes siteqwerq@gmail.comChina 
22-Oct-14 02:5262.210.142.7Patricsteep777@yahoo.comFranceEvidence
22-Oct-14 02:5236.248.187.180sdinboyuhtenableure@yahoo.comChina 
22-Oct-14 02:5282.102.24.33Charlescypeschlensker699dana@hotmail.comPortugal 
22-Oct-14 02:5262.210.142.7Alexisnogood87@yahoo.comFranceEvidence
22-Oct-14 02:52199.15.233.169Evangelinurcbeyourselffor@gmail.comUnited States 
22-Oct-14 02:5162.210.142.7Oliverthebest@hotmail.comFranceEvidence
22-Oct-14 02:51110.86.70.171gavinchow28debtorllzg@gmail.com
[ de.bto.r.llzg@gmail.com ]
China 
22-Oct-14 02:51192.255.96.54HYhouweefshinton@join.feamail.com 
22-Oct-14 02:5146.0.57.167AshBrielsleonid340i@gmail.comRussian FederationEvidence
22-Oct-14 02:51178.45.83.189AshBrielsleonid340i@gmail.comRussian FederationEvidence
22-Oct-14 02:51117.26.79.28k93q29detectonicgylf@gmail.com
[ tect.o.n.i.cg.ylf@gmail.com ]
ChinaEvidence
22-Oct-14 02:51199.15.233.186RobertFokgkljgbk@mail.ruUnited StatesEvidence
22-Oct-14 02:51110.89.46.2300757xaes50greetingspmaip@gmail.com
[ gree.t.i.n.gsp.ma.i.p@gmail.com ]
ChinaEvidence
22-Oct-14 02:51178.19.108.205rtumxdpsmzpsgahvuedu@fhhpovbwjrh.comPoland 
22-Oct-14 02:5194.41.48.114RaymondTomsraymondlupei@yandex.ruRussian Federation 
22-Oct-14 02:5162.210.211.91SSelbysuffrage@outlook.comFrance 
22-Oct-14 02:51107.183.140.106Aliceplgtworkyxmkb@gmail.com 
22-Oct-14 02:51193.150.120.60EdmondHaxedmondhitr@yandex.ruRussian Federation 
22-Oct-14 02:51140.237.39.198pacdffgsvdrzqoinstructqfho@gmail.com
[ i.ns.tr.u.c.t.q.f.h.o@gmail.com ]
China 
22-Oct-14 02:51110.89.46.2308809uyht46greetingspmaip@gmail.com
[ gr.ee.ting.s.pma.i.p@gmail.com ]
ChinaEvidence
22-Oct-14 02:5178.9.152.43BFornachocindifanny603@hulapla.dePoland 
22-Oct-14 02:51184.95.56.219VUthiskhkvge@yahoo.comUnited States 
22-Oct-14 02:51222.77.215.140Xm1SLzblr2inasmuchjbblo@gmail.com
[ i.n.asmuc.hjbblo@gmail.com ]
China 
22-Oct-14 02:51110.89.46.2302721swap47greetingspmaip@gmail.com
[ g.reetin.g.s.p.m.a.ip@gmail.com ]
ChinaEvidence
22-Oct-14 02:51110.89.46.2307156ytju74greetingspmaip@gmail.com
[ g.re.eti.ng.spmaip@gmail.com ]
ChinaEvidence
22-Oct-14 02:51110.89.46.2305175yina88greetingspmaip@gmail.com
[ g.r.e.etin.gsp.m.a.ip@gmail.com ]
ChinaEvidence
22-Oct-14 02:51121.207.181.28dfrok89gcedogfishhomo@hotmail.comChina 
22-Oct-14 02:51120.43.28.74hauebdoyudererahmiths19608@gmail.com
[ d.er.er.a.h.miths19608@gmail.com ]
ChinaEvidence
22-Oct-14 02:5159.174.167.65sifxopvbdelbrauc03@gugoumail.comChina 
22-Oct-14 02:51110.86.70.171mattie586debtorllzg@gmail.com
[ de.b.tor.l.l.zg@gmail.com ]
China 
22-Oct-14 02:51199.15.233.169Helenotebeyourselffor@gmail.comUnited States 
22-Oct-14 02:51192.99.6.22RUXMjulianbalbiisye@yahoo.comCanada 
22-Oct-14 02:5137.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
22-Oct-14 02:5176.164.224.141GeorgeIrotdhubmv@easyblogs.bizUnited States 
22-Oct-14 02:51120.37.235.49rqfgdhgrpqtransposemivnm@gmail.com
[ t.ra.n.s.po.semi.vnm@gmail.com ]
China 
22-Oct-14 02:5137.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
22-Oct-14 02:51195.211.154.175jackqvsrirurteyrodweijfoekdls@gmail.comUkraine 
22-Oct-14 02:51120.37.236.197louis vuitton carry on bagpargrxzo@gmail.comChina 
22-Oct-14 02:5146.161.41.144Charlestewmr.vayn@yourmoneybinary.comRussian Federation 
22-Oct-14 02:5127.153.230.217lkhgfdtcxacceleratetwxtpi@gmail.com
[ a.c.cele.r.at.et.wx.tp.i@gmail.com ]
ChinaEvidence
22-Oct-14 02:51199.15.233.189Th9zpekd7srxafeaqr457@hotmail.comUnited States 
22-Oct-14 02:51110.85.102.4lmngdcvnzqportioniluoig@gmail.com
[ p.ortio.ni.l.uoi.g@gmail.com ]
China 
22-Oct-14 02:5178.9.152.43DAdixievandiver@discardmail.comPolandEvidence
22-Oct-14 02:5182.102.24.33Charlesbusaschlensker699dana@hotmail.comPortugal 
22-Oct-14 02:51120.43.27.191rfdsggdhggtlinstallukkqr@gmail.com
[ i.ns.tall.uk.kqr@gmail.com ]
ChinaEvidence
22-Oct-14 02:51110.85.102.4lmngdcvztiportioniluoig@gmail.com
[ p.o.rti.o.ni.lu.o.i.g@gmail.com ]
China 
22-Oct-14 02:51176.31.18.225santosmFmhktwalshjay44@gmail.com
[ walshjay44+549414669@gmail.com ]
FranceEvidence
22-Oct-14 02:51104.151.230.82hunterlefroyzyulynnxad@hotmail.com 
22-Oct-14 02:51110.89.53.94ljdedseyronsbreleasevdqr@gmail.com
[ r.e.l.eas.evd.q.r@gmail.com ]
ChinaEvidence
22-Oct-14 02:51222.79.79.59Burhhdnlpqweaponrynupl@gmail.com
[ w.eaponry.n.u.p.l@gmail.com ]
China 
22-Oct-14 02:51198.27.65.219GilbertPtgilbertzexwc@hichristianlouboutinukdiscount.co.ukCanada 
22-Oct-14 02:51198.27.65.219Alfredenalfredkire@newjordanshoes.usCanada 
22-Oct-14 02:51198.27.65.219AlfredgeROalfrednobre@newjordanshoes.usCanada 
22-Oct-14 02:51198.27.65.219Richardbekrichardvityzl@myjordanshoes.usCanada 
22-Oct-14 02:51198.27.65.219JackieNiskjackieenxw@westjordanshoes.usCanada 
22-Oct-14 02:51198.27.65.219GilbertKngilbertmighwc@hichristianlouboutinukdiscount.co.ukCanada 
22-Oct-14 02:51110.89.63.94nygsbkawzhjingbixinjl129@126.comChina 
22-Oct-14 02:51198.27.65.219JackieNevyjackievuhxw@westjordanshoes.usCanada 
22-Oct-14 02:51198.27.65.219RichardRarrichardduhzl@myjordanshoes.usCanada 
22-Oct-14 02:51198.27.65.219JackieNiskjackieenxw@westjordanshoes.usCanada 
22-Oct-14 02:51173.208.48.84VParadismurkyflaw39hyno@ovi.comUnited States 
22-Oct-14 02:51126.19.106.62VAllsopuiphgcynrl@sohu.comJapan 
22-Oct-14 02:5136.250.176.15lyqduwx479toledojkt76@gmail.com
[ t.ol.e.d.oj.k.t76@gmail.com ]
China 
22-Oct-14 02:51198.27.65.219GilbertKngilbertmighwc@hichristianlouboutinukdiscount.co.ukCanada 
22-Oct-14 02:51198.27.65.219RichardRarrichardduhzl@myjordanshoes.usCanada 
22-Oct-14 02:51198.27.65.219AlfredDumealfredeare@newjordanshoes.usCanada 
22-Oct-14 02:51110.89.34.241louis vuitton men utah leatherfdgzghxfhfg@gmail.comChina 
22-Oct-14 02:50104.151.230.82mammieokrmnxfrgddtxcliffezmf@hotmail.com 
22-Oct-14 02:5095.69.241.116Charlesplsedumdqueu@mailontherail.netUkraine 
22-Oct-14 02:50120.43.10.145lv Avalon MM replicadzgdfhgfhfgh@gmail.comChina 
22-Oct-14 02:50195.154.177.139CMatthewsgris@cpafederation.comFrance 
22-Oct-14 02:5059.58.157.219cheap lv Marylebone GMxfhfghgjhjjh@gmail.comChina 
22-Oct-14 02:50116.236.216.116ljdwefdsyrovzycanaryjyehdh@gmail.com
[ ca.n.aryjy.eh.dh@gmail.com ]
China 
22-Oct-14 02:50110.85.103.238ljdwefdsyrownyopponentdfiw@gmail.com
[ op.pon.ent.d.f.i.w@gmail.com ]
China 
22-Oct-14 02:50104.151.230.82hildegardcomeauxranadvp@hotmail.com 
22-Oct-14 02:50222.77.218.125ljdwefdsyrovzycanaryjyehdh@gmail.com
[ ca.n.aryjy.eh.dh@gmail.com ]
China 
22-Oct-14 02:5036.248.187.79coach factory outletvjrpdulavrh@gmail.comChina 
22-Oct-14 02:5060.199.178.103baanatpetrova4962baanatpetrova@cmail.comTaiwan, Province of China 
22-Oct-14 02:50134.249.141.83igYvxhpempty@unknown.comUkraine 
22-Oct-14 02:50183.207.228.3UEellison93755@outlook.comChina 
22-Oct-14 02:50104.151.230.82ncqdominicsdatlmartialgrad@yahoo.com 
22-Oct-14 02:50195.211.155.138WvOWKxptvXeclipsezuuqih@gmail.com
[ ec.l.ip.se.zuu.qi.h@gmail.com ]
Ukraine 
22-Oct-14 02:50120.33.217.42pasyaerzsclongtermuaklbw@gmail.com
[ l.on.gt.e.rmu.ak.lb.w@gmail.com ]
China 
22-Oct-14 02:5027.153.230.217lddshgffdovbtacceleratetwxtpi@gmail.com
[ a.cc.el.era.t.e.tw.x.t.pi@gmail.com ]
China 
22-Oct-14 02:50155.133.19.61IVstokrotkalg01@gmail.com
[ s.t.ok.r.otka.lg01@gmail.com ]
Germany 
22-Oct-14 02:5076.164.226.10yrbflworcvcrfert5436hd@gmail.comUnited States 
22-Oct-14 02:50107.183.140.98gyyfreemandybviot7cheap@k.maybebest.com
[ t7cheap+uggs+onlinefank@k.maybebest.com ]
 
22-Oct-14 02:5062.210.167.213Arianacrazyivan@yahoo.comFranceEvidence
22-Oct-14 02:5062.210.167.213deadmanheyjew@msn.comFranceEvidence
22-Oct-14 02:5062.210.167.213Briangoodsam@gmail.comFranceEvidence
22-Oct-14 02:5062.210.167.213Genesiscrazyfrog@hotmail.comFranceEvidence
22-Oct-14 02:50195.211.155.217clintmarzanoffibingsshaneox@hotmail.comUkraine 
22-Oct-14 02:5062.210.167.213Diegoinfest@msn.comFranceEvidence
22-Oct-14 02:5091.200.12.53PaGGTyrccSconcedeiidilr@gmail.com
[ conc.edei.i.di.lr@gmail.com ]
UkraineEvidence
22-Oct-14 02:5046.118.121.75Phyllisrinyphylis94zi@gmail.comUkraineEvidence
22-Oct-14 02:5091.200.12.53GfJEQyiygZconcedeiidilr@gmail.com
[ c.on.c.e.d.e.i.i.dilr@gmail.com ]
UkraineEvidence
22-Oct-14 02:50222.77.218.86kfgfdhdpebbuckskinjfjhf@gmail.com
[ bu.c.ksk.inj.f.j.hf@gmail.com ]
China 
22-Oct-14 02:50109.168.250.16Ataronfumjohnnieuj@yandex.comRussian FederationEvidence
22-Oct-14 02:5061.50.245.133cuseQuorectyfvdofo612@gmail.comChina 
22-Oct-14 02:50122.96.59.105cuseQuorectyfvdofo612@gmail.comChina 
22-Oct-14 02:5046.0.57.167AshBrielsleonid340i@gmail.comRussian FederationEvidence
22-Oct-14 02:5069.12.64.239RZ37leliaperesfqjm@yahoo.comUnited States 
22-Oct-14 02:50117.26.79.28k93q29detectonicgylf@gmail.com
[ tect.o.n.i.cg.ylf@gmail.com ]
ChinaEvidence
22-Oct-14 02:50110.89.46.2300757xaes50greetingspmaip@gmail.com
[ gree.t.i.n.gsp.ma.i.p@gmail.com ]
ChinaEvidence
22-Oct-14 02:50204.44.65.215bv77z8tj11hgvseg4564gvsw@126.comUnited States 
22-Oct-14 02:5027.18.72.16Douglassizxiyangyang1121@hotmail.comChina 
22-Oct-14 02:50183.223.171.198tolayatimshuktolayatimshuk@yandex.ruChina 
22-Oct-14 02:5091.207.6.98cuseQuorectyfvdofo612@gmail.comUkraine 
22-Oct-14 02:50117.169.1.96CVanhoosepiperlopez7611@mailcatch.comChina 
22-Oct-14 02:5046.105.248.255gitahswfsyoblmomfjoellenperrottiuvjh@yahoo.comFrance 
22-Oct-14 02:5027.159.213.144fbfbvruuxsegmentvvmihv@gmail.com
[ se.gme.ntvv.mihv@gmail.com ]
China 
22-Oct-14 02:50195.211.155.217kathaleencaringtonbingsshaneox@hotmail.comUkraine 
22-Oct-14 02:50209.0.50.242M8172uglyclaw73sr631@outlook.comUnited States 
22-Oct-14 02:50183.207.228.3CKcortez51989@outlook.comChina 
22-Oct-14 02:50110.89.46.2302721swap47greetingspmaip@gmail.com
[ g.reetin.g.s.p.m.a.ip@gmail.com ]
ChinaEvidence
22-Oct-14 02:50110.89.46.2307156ytju74greetingspmaip@gmail.com
[ g.re.eti.ng.spmaip@gmail.com ]
ChinaEvidence
22-Oct-14 02:50110.89.46.2305175yina88greetingspmaip@gmail.com
[ g.r.e.etin.gsp.m.a.ip@gmail.com ]
ChinaEvidence
22-Oct-14 02:50110.89.46.2308809uyht46greetingspmaip@gmail.com
[ gr.ee.ting.s.pma.i.p@gmail.com ]
ChinaEvidence
22-Oct-14 02:50195.211.155.217shantaegrabowskibingsshaneox@hotmail.comUkraine 
22-Oct-14 02:50120.43.28.74hauebdoyudererahmiths19608@gmail.com
[ d.er.er.a.h.miths19608@gmail.com ]
ChinaEvidence
22-Oct-14 02:50199.15.233.187Gisellecehbeyourselffor@gmail.comUnited StatesEvidence
22-Oct-14 02:50190.185.37.135ChristoBEPHelois75blowersfeglg@mail.ruNetherlands Antilles 
22-Oct-14 02:50199.15.233.187Ameliaxbsbeyourselffor@gmail.comUnited States 
22-Oct-14 02:49195.211.155.217lyleiubuzbrdemgimsfbingsshaneox@hotmail.comUkraine 
22-Oct-14 02:49117.169.1.129RWaechterlavinalukis8855@discardmail.comChina 
22-Oct-14 02:495.255.73.98CortezMcCarthylewiestearnskhm@yahoo.comNetherlands 
22-Oct-14 02:49120.37.235.49kfgfdhdyrgtransposemivnm@gmail.com
[ t.ransp.os.e.m.iv.nm@gmail.com ]
China 
22-Oct-14 02:49110.89.41.251http://www.unitedgroups-ho.com/flash/index.aspygwhntin@gmail.comChinaEvidence
22-Oct-14 02:49117.26.248.6pasyaerywccomedyolwh@gmail.com
[ c.om.e.d.y.o.l.w.h@gmail.com ]
ChinaEvidence
22-Oct-14 02:49110.89.41.251http://www.cec-eg.com/member.aspygwhntin@gmail.comChinaEvidence
22-Oct-14 02:49183.207.228.10venedvurqmshibiyanhl862@126.comChina 
22-Oct-14 02:49120.37.238.67ljdedseyroazpcampaigncomp@gmail.com
[ c.amp.a.ignc.om.p@gmail.com ]
China 
22-Oct-14 02:4914.110.176.182Mamwyisokethg@newsinhouse.comChinaEvidence
22-Oct-14 02:49222.79.79.59Bvxkgelizfweaponrynupl@gmail.com
[ wea.p.o.n.r.y.nup.l@gmail.com ]
China 
22-Oct-14 02:49216.244.71.3Georgecomneldaagd@hotmail.comUnited States 
22-Oct-14 02:49178.45.83.189AshBrielsleonid340i@gmail.comRussian FederationEvidence
22-Oct-14 02:49110.89.53.195rfxcvcgdhgfyksewagequzda@gmail.com
[ sew.ag.e.quzda@gmail.com ]
ChinaEvidence
22-Oct-14 02:49162.244.14.159ADeSalissd2@fastdeal.com.br 
22-Oct-14 02:49220.161.169.110pacdffgsvdryryindenturerknr@gmail.com
[ inde.n.tu.rerk.nr@gmail.com ]
China 
22-Oct-14 02:49198.12.74.187FrancisGrogantommytwhws@yahoo.comUnited States 
22-Oct-14 02:49120.43.27.191rfdsggdhgyxzinstallukkqr@gmail.com
[ i.n.st.a.llu.kkqr@gmail.com ]
ChinaEvidence
22-Oct-14 02:4927.159.205.46gueyvaqf]apteroust@hotmail.comChina 
22-Oct-14 02:49120.43.16.65venedvurqmshibiyanhl862@126.comChina 
22-Oct-14 02:4927.159.202.59pasyaertmlcontendergizp@gmail.com
[ contend.e.rgizp@gmail.com ]
ChinaEvidence
22-Oct-14 02:4927.153.230.217reyrgubuacceleratetwxtpi@gmail.com
[ accel.er.a.t.et.w.x.tp.i@gmail.com ]
ChinaEvidence
22-Oct-14 02:49176.119.3.46BrendanPrcornell554yer@hotmail.comUkraine 
22-Oct-14 02:49110.89.27.68ljdwefdsyrowoumarketingpgjn@gmail.com
[ ma.r.keti.n.gpgj.n@gmail.com ]
ChinaEvidence
22-Oct-14 02:49222.77.218.86rqfgdhgwstbuckskinjfjhf@gmail.com
[ bu.c.ksk.i.njf.j.hf@gmail.com ]
China 
22-Oct-14 02:49202.162.199.241GayRKKrblnlqidiaomeo069634@163.comIndonesia 
22-Oct-14 02:49176.31.126.153udivoxehetoyugup@dfgggg.orgFranceEvidence
22-Oct-14 02:49110.89.27.29ljdedseyrotbuappointjmxwno@gmail.com
[ app.o.in.tjm.x.wno@gmail.com ]
China 
22-Oct-14 02:49140.237.39.198pacdffgsvdrctsinstructqfho@gmail.com
[ i.nstruc.tqfho@gmail.com ]
China 
22-Oct-14 02:49120.43.30.179ljdedseyrodsdtabulaterzom@gmail.com
[ tab.ulat.erzo.m@gmail.com ]
ChinaEvidence
22-Oct-14 02:49110.86.186.191ronfzronalricknezf@hotmail.comChinaEvidence
22-Oct-14 02:49107.168.10.249APolleyadeline.polley@ketchiethecit1975.carinsurancelite.comEvidence
22-Oct-14 02:49107.153.64.161KirstenHxnsharistartzmantnf@yahoo.com 
22-Oct-14 02:49110.89.27.29pasyaerwqqappointjmxwno@gmail.com
[ app.o.i.n.t.j.m.xw.no@gmail.com ]
China 
22-Oct-14 02:4959.58.156.41lv Galatea PM pricegfxghfhxfg@gmail.comChina 
22-Oct-14 02:49204.44.90.178elliotfreelxnpjsvbcpbigballtina@outlook.comUnited States 
22-Oct-14 02:49110.89.53.94pasyaerryoreleasevdqr@gmail.com
[ r.el.e.asevdqr@gmail.com ]
China 
22-Oct-14 02:4927.153.231.47pacdffgsvdrotwfeatureuhhv@gmail.com
[ f.eatu.reuh.hv@gmail.com ]
ChinaEvidence
22-Oct-14 02:4927.159.211.116ffgjhggnriptmodestlyfettlk@gmail.com
[ m.o.de.s.tl.yf.e.ttlk@gmail.com ]
ChinaEvidence
22-Oct-14 02:49117.27.138.181buicuoushuoisgoas09saa@hotmail.comChina 
22-Oct-14 02:49110.85.102.4lmngdcvzvzportioniluoig@gmail.com
[ p.o.rt.io.n.ilu.oig@gmail.com ]
ChinaEvidence
22-Oct-14 02:49199.15.233.167Evangeliniopbeyourselffor@gmail.comUnited StatesEvidence
22-Oct-14 02:4994.23.251.168tiixehfefutiafumuri@gmaieredd.comFranceEvidence
22-Oct-14 02:49222.77.218.125pacdffgsvdrutacanaryjyehdh@gmail.com
[ cana.r.yj.yehd.h@gmail.com ]
ChinaEvidence
22-Oct-14 02:49195.211.155.143TqZFNrvokWwhereasryktgt@gmail.com
[ w.he.re.asr.yk.tg.t@gmail.com ]
Ukraine 
22-Oct-14 02:49195.211.155.143AkNUHvuokXwhereasryktgt@gmail.com
[ whe.rea.s.ry.kt.gt@gmail.com ]
Ukraine 
22-Oct-14 02:49120.37.235.49rqfgdhghfitransposemivnm@gmail.com
[ t.rans.p.os.em.ivn.m@gmail.com ]
China 
22-Oct-14 02:49196.196.18.92KMirelescosahouca1980@yahoo.comSeychelles 
22-Oct-14 02:49193.182.146.77GYalejandrinamcclenahanfdtm@yahoo.comSwedenEvidence
22-Oct-14 02:49120.37.234.9ffcxsdhdnoqsewagequzda@gmail.com
[ s.e.wag.e.q.uzda@gmail.com ]
ChinaEvidence
22-Oct-14 02:4927.153.229.70arreseduthallmarkhpxk@gmail.com
[ h.al.l.ma.r.kh.px.k@gmail.com ]
ChinaEvidence
22-Oct-14 02:4991.236.74.251HParerb@atrais-kredits24.comPoland 
22-Oct-14 02:4937.72.189.2monar41qytrzrenlzbgrrega27@outlook.comUnited States 
22-Oct-14 02:4927.153.231.47ljdwefdsyroaeqfeatureuhhv@gmail.com
[ fea.t.u.r.eu.h.hv@gmail.com ]
ChinaEvidence
22-Oct-14 02:49120.37.235.49ffcxsdhdeimtransposemivnm@gmail.com
[ t.ran.sp.osemiv.n.m@gmail.com ]
ChinaEvidence
22-Oct-14 02:49204.44.126.200norrisduffyamdhrupavel.eromin_2778@yahoo.comUnited States 
22-Oct-14 02:4962.210.82.148HKnopwoodmelyndanaftzgerkjmh@yahoo.comFranceEvidence
22-Oct-14 02:49120.43.25.88pacdffgsvdrxxsconsumerkzybzs@gmail.com
[ c.ons.ume.rkz.yb.z.s@gmail.com ]
ChinaEvidence
22-Oct-14 02:49155.133.19.64XQdoloresheyward@mailcatch.comGermany 
22-Oct-14 02:49120.37.235.49rfxcvcgdhgskrtransposemivnm@gmail.com
[ tra.n.s.p.os.emi.vn.m@gmail.com ]
ChinaEvidence
22-Oct-14 02:49198.100.156.94SGbradleywelker2312@mailcatch.comUnited States 
22-Oct-14 02:49193.201.224.154saildeldelohormonallopxd@gmail.comUkraineEvidence
22-Oct-14 02:4946.161.41.108Ronaldsimedoruxich9@mail.ruRussian FederationEvidence
22-Oct-14 02:49193.150.120.59AKneellVerSrjmcznb@sfrty.ruRussian FederationEvidence
22-Oct-14 02:4980.72.35.84TDhermosilla68869@amid.co.plPoland 
22-Oct-14 02:4980.72.35.84HWhitwortgetto93352@acyl.co.plPoland 
22-Oct-14 02:49195.211.155.143OhPUGcnlmSwhereasryktgt@gmail.com
[ where.as.ry.kt.g.t@gmail.com ]
Ukraine 
22-Oct-14 02:49140.237.39.195pacdffgsvdraaqrescueuilc@gmail.com
[ r.e.scu.e.uilc@gmail.com ]
China 
22-Oct-14 02:4927.159.202.59pasyaeryakcontendergizp@gmail.com
[ c.o.ntende.rg.izp@gmail.com ]
ChinaEvidence
22-Oct-14 02:4937.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
22-Oct-14 02:4927.17.69.106carpinswwaohualalalwqwq123@hotmail.comChinaEvidence
22-Oct-14 02:4983.6.244.228TW18@1n.kinefi.plPoland 
22-Oct-14 02:49110.85.103.238ljdwefdsyrobgfopponentdfiw@gmail.com
[ op.po.n.e.n.tdfi.w@gmail.com ]
ChinaEvidence
22-Oct-14 02:49120.37.234.9kfgfdhdaiusewagequzda@gmail.com
[ s.e.w.ag.equz.da@gmail.com ]
ChinaEvidence
22-Oct-14 02:49193.150.120.59AWrorginorjmcznb@sfrty.ruRussian Federation 
22-Oct-14 02:48120.37.235.117lhggjfdohnudebtorkotets@gmail.com
[ d.ebt.orkotet.s@gmail.com ]
China 
22-Oct-14 02:4827.159.202.59pasyaerweqcontendergizp@gmail.com
[ co.nte.n.d.e.r.g.iz.p@gmail.com ]
China 
22-Oct-14 02:48112.111.165.69htxfp6099esiengnnslkngl22kjls@gmail.com
[ s.ien.gnns.l.kn.g.l22kjls@gmail.com ]
China 
22-Oct-14 02:48117.26.79.28k93q29detectonicgylf@gmail.com
[ tect.o.n.i.cg.ylf@gmail.com ]
ChinaEvidence
22-Oct-14 02:48110.86.70.171coleselby17debtorllzg@gmail.com
[ de.b.torl.l.zg@gmail.com ]
China 
22-Oct-14 02:48110.86.70.171tydale00debtorllzg@gmail.com
[ debto.rll.zg@gmail.com ]
China 
22-Oct-14 02:48175.42.95.252cegsm43o99gagasdf2303sjga3235ga@gmail.com
[ ga.ga.s.df.2.30.3s.jga.3235ga@gmail.com ]
China 
22-Oct-14 02:48197.224.58.94walzewal_2004@netcourrier.comMauritius 
22-Oct-14 02:48117.26.77.195Louis Vuitton Conspriration Ovale replicambu@gmail.comChina 
22-Oct-14 02:48122.96.59.105Michaelkaamul.aila@ufrbox.netChina 
22-Oct-14 02:48159.224.160.202Michaelkaamul.aila@ufrbox.netUkraine 
22-Oct-14 02:4846.0.57.167AshBrielsleonid340i@gmail.comRussian FederationEvidence
22-Oct-14 02:4827.154.45.146cpmrzozzpkgymnasticyiil@gmail.com
[ gymnasticyiil+bpjqpl@gmail.com ]
China 
22-Oct-14 02:48140.237.3.153awtheiwmwhxuyixuanmc213@126.comChinaEvidence
22-Oct-14 02:48120.43.28.74hauebdoyudererahmiths19608@gmail.com
[ d.er.er.a.h.miths19608@gmail.com ]
ChinaEvidence
22-Oct-14 02:48122.143.3.75mmiusfhghxdoudabaops329@126.comChina 
22-Oct-14 02:48110.89.27.29pasyaeriuiappointjmxwno@gmail.com
[ appo.in.tjm.x.w.n.o@gmail.com ]
ChinaEvidence
22-Oct-14 02:48222.77.218.86rfxcvcgdhgnwnbuckskinjfjhf@gmail.com
[ b.u.c.ks.k.i.njfjh.f@gmail.com ]
China 
22-Oct-14 02:4827.159.218.154mmiusfhghxdoudabaops329@126.comChina 
22-Oct-14 02:48198.27.65.193JosephMesjosephsazc@mymulberrybags.usCanada 
22-Oct-14 02:48142.4.215.59Felipefatefelipemipek@cheapchristianlouboutindiscount.comCanada 
22-Oct-14 02:48198.27.65.193Herbertnamherbertagexgj@longchamponlinesale.comCanada 
22-Oct-14 02:4859.58.159.44imitation louis vuitton clutch pursexgfhhjfustdres@gmail.comChina 
22-Oct-14 02:4846.161.41.11TimothyWozybzezaek@mail.ruRussian Federation 
22-Oct-14 02:48120.37.235.117yiyhngdjyyhwdebtorkotets@gmail.com
[ de.bt.o.rko.te.t.s@gmail.com ]
ChinaEvidence
22-Oct-14 02:48222.79.79.59Busnqvbzykweaponrynupl@gmail.com
[ wea.p.onrynu.pl@gmail.com ]
China 
22-Oct-14 02:4836.248.187.219brs40awcyjqjgiljfoslialanlalna@gmail.com
[ qj.gi.lj.fosl.iala.nlalna@gmail.com ]
China 
22-Oct-14 02:48216.244.81.171dmahvUqiepiphyllumas2@gmail.com
[ epiphyllum.as.2@gmail.com ]
United StatesEvidence
22-Oct-14 02:4827.159.233.151Air Jordan IX XIV Retro Countdown Package for saledsgfsdfgdfgdf@gmail.comChina 
22-Oct-14 02:48123.125.81.247IVniceallegory46oeqfn@yahoo.comChina 
22-Oct-14 02:48117.30.35.121toddgoren15restrictroid@gmail.com
[ r.est.r.i.c.troid@gmail.com ]
China 
22-Oct-14 02:48178.45.83.189AshBrielsleonid340i@gmail.comRussian FederationEvidence
22-Oct-14 02:48218.59.144.69FionaCurtneuronsemi@hotmail.comChina 
22-Oct-14 02:4827.153.137.212huaxypfs219laowiusdaheghjsa@gmail.com
[ lao.wiu.sda.heg.hjsa@gmail.com ]
ChinaEvidence
22-Oct-14 02:48175.44.56.53canada goose kensington parka gris clair femmerosalinacoldiron@gmail.com
[ rosalina.coldiron@gmail.com ]
ChinaEvidence
22-Oct-14 02:4827.159.237.4Air Jordan Spizike salezdgdfgdfghdfh@gmail.comChina 
22-Oct-14 02:48117.30.35.121nealkhan23restrictroid@gmail.com
[ res.tr.ic.troid@gmail.com ]
China 
22-Oct-14 02:48117.30.35.121marcshaw77restrictroid@gmail.com
[ r.estrict.ro.i.d@gmail.com ]
China 
22-Oct-14 02:48175.42.95.253sim0sqv4K47sejlgjlsso9iuj3jsll@gmail.com
[ s.ej.l.gj.l.s.s.o9i.uj3jsll@gmail.com ]
China 
22-Oct-14 02:48110.86.70.171devin165debtorllzg@gmail.com
[ d.e.bt.o.r.llzg@gmail.com ]
China 
22-Oct-14 02:4827.153.231.47ljdwefdsyroeeafeatureuhhv@gmail.com
[ f.ea.tur.e.uhhv@gmail.com ]
China 
22-Oct-14 02:4737.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
22-Oct-14 02:4727.159.211.116lghfgghdosqsmodestlyfettlk@gmail.com
[ m.o.de.stl.yfe.t.t.lk@gmail.com ]
China 
22-Oct-14 02:4727.159.202.59ljdedseyrogfxcontendergizp@gmail.com
[ c.onte.nde.r.gi.zp@gmail.com ]
ChinaEvidence
22-Oct-14 02:47222.77.200.108dfds9467582densityqsje@gmail.comChina 
22-Oct-14 02:47222.77.200.108dfds1024582lubricatordofn@gmail.comChina 
22-Oct-14 02:47222.79.79.59Bluiiakxweweaponrynupl@gmail.com
[ weapo.nrynu.pl@gmail.com ]
China 
22-Oct-14 02:4769.12.70.118GQtristanherobsd508@outlook.comUnited States 
22-Oct-14 02:47162.244.14.185tonjahilliervojeiopociekysnr@yahoo.com 
22-Oct-14 02:4788.80.21.107PMcLendonjeremybourhis661@gmail.com
[ j.e.r.e.myb.o.u.r.h.i.s.6.61@gmail.com ]
Sweden 
22-Oct-14 02:47142.4.215.59FelipeLefefelipecereek@cheapchristianlouboutindiscount.comCanada 
22-Oct-14 02:4737.187.89.77Nevaehbonser@gmail.comFranceEvidence
22-Oct-14 02:4737.187.89.77Adrianpitfighter@hotmail.comFranceEvidence
22-Oct-14 02:4737.187.89.77Kevinsteep777@yahoo.comFranceEvidence
22-Oct-14 02:4737.187.89.77Michellebehappy@yahoo.comFranceEvidence
22-Oct-14 02:4737.187.89.77Graceinfest@msn.comFranceEvidence
22-Oct-14 02:4723.106.211.9PBeliveauphillis.beliveau8@outlook.comUnited States 
22-Oct-14 02:47120.37.235.92rqfgdhgqnmbiologicalffknz@gmail.com
[ bio.lo.gi.cal.ff.knz@gmail.com ]
China 
22-Oct-14 02:4796.47.224.42Dr Oz Miracle Garcinia Cambogiarmfpelswmq@pjbblk.comUnited States 
22-Oct-14 02:47198.27.65.193JosephPrjosephmuthzc@mymulberrybags.usCanada 
22-Oct-14 02:47173.234.164.5BXqejxwilmer@hotmail.comUnited States 
22-Oct-14 02:4759.58.156.246replica Louis Vuitton Lxgjkhhgfgjgyfdfg@gmail.comChina 
22-Oct-14 02:47198.27.65.85Manuelnentmanuelcigevw@hichristianlouboutinuksale.co.ukCanada 
22-Oct-14 02:47162.244.14.185yocsiobhanhxltujrpociekysnr@yahoo.com 
22-Oct-14 02:47198.100.149.177MHernandextbsmoldo@yahoo.co.ukCanada 
22-Oct-14 02:47183.207.228.3QKroyalboyfriend380255@outlook.comChina 
22-Oct-14 02:4794.229.21.72CharlesBurolinjunfang@outlook.comRussian Federation 
22-Oct-14 02:47120.37.235.49rqfgdhgcujtransposemivnm@gmail.com
[ tran.spo.se.m.i.vn.m@gmail.com ]
China 
22-Oct-14 02:4760.206.153.177LeraSpowlzugsdysopa1973@freemoney.pwChina 
22-Oct-14 02:47155.133.19.61MBrookfiejulian01_04@wp.plGermany 
22-Oct-14 02:47198.27.65.193Kennethsnickennethvogqp@hotpradabagsoutlet.usCanada 
22-Oct-14 02:47198.27.65.193Josephropyjosephsynczc@mymulberrybags.usCanada 
22-Oct-14 02:47162.244.14.185pablomckeannallociekysnr@yahoo.com 
22-Oct-14 02:47183.207.228.3XBorganicfacsimilnndly5b@outlook.comChina 
22-Oct-14 02:47116.228.55.217fytparbpnsjingbixinjl129@126.comChina 
22-Oct-14 02:47175.42.44.161tretd49js43ml43hsenbqwork@outlet36.comChina 
22-Oct-14 02:47198.100.149.177DCliffordxtbsmoldo@yahoo.co.ukCanada 
22-Oct-14 02:4768.71.139.176mhidelilahbksxtfpjeztanahendriksebfu@yahoo.comUnited States 
22-Oct-14 02:47183.207.228.3RRrichards8xaqce@outlook.comChina 
22-Oct-14 02:4789.209.82.209LeraSpowlzugsdysopa1973@freemoney.pwUkraine 
22-Oct-14 02:4727.159.201.7yuyut7vjhstrenuouscxoft@gmail.com
[ s.tre.n.uou.scx.oft@gmail.com ]
China 
22-Oct-14 02:47193.150.120.82MichaelBymnasczczxzvxvdsacsdsljljkjkljl@gmail.comRussian FederationEvidence
22-Oct-14 02:47162.244.14.185bennylaporteyamqsteasdhvnd@yahoo.com 
22-Oct-14 02:47199.15.233.187Helensvxbeyourselffor@gmail.comUnited States 
22-Oct-14 02:47193.201.224.96quaitokuvifelymanjoe656809@gmail.com
[ fe.l.ymanjoe656809@gmail.com ]
Ukraine 
22-Oct-14 02:4746.246.39.184CalvinNutsmeghannoonypfn039@outlook.comSweden 
22-Oct-14 02:47117.26.249.209ivi4gyy1jcelebratetkaymv@gmail.com
[ ce.le.b.rat.e.tkaymv@gmail.com ]
China 
22-Oct-14 02:47117.26.249.209ikf2hvy0kcelebratetkaymv@gmail.com
[ c.e.l.e.b.rat.e.tkaymv@gmail.com ]
China 
22-Oct-14 02:46117.26.249.209n3xoazsnrcelebratetkaymv@gmail.com
[ c.el.e.br.at.e.tkaymv@gmail.com ]
China 
22-Oct-14 02:46110.89.63.94fytparbpnsjingbixinjl129@126.comChina 
22-Oct-14 02:46183.207.228.3KHrichmond97031@outlook.comChina 
22-Oct-14 02:4627.153.231.47pacdffgsvdrotwfeatureuhhv@gmail.com
[ f.eatu.reuh.hv@gmail.com ]
China 
22-Oct-14 02:46198.27.65.193Kennethnepkennethsric@mulberrybagsgroup.usCanada 
22-Oct-14 02:46198.12.72.114shantaepmpvvtfjehoooxlifseypyyn@yahoo.comUnited States 
22-Oct-14 02:4646.0.57.167AshBrielsleonid340i@gmail.comRussian FederationEvidence
22-Oct-14 02:4637.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
22-Oct-14 02:4646.118.113.196ikidcawixotiyisulucax@emailrtg.orgUkraineEvidence
22-Oct-14 02:4669.12.88.105rodcervantesfcuxlifseypyyn@yahoo.comUnited States 
22-Oct-14 02:4637.57.231.125AbizyaloHotkisorjeronimo@gmail.comUkraineEvidence
22-Oct-14 02:46120.43.25.55AjBBDfczzEwhereasryktgt@gmail.com
[ w.h.ere.asr.ykt.gt@gmail.com ]
ChinaEvidence
22-Oct-14 02:46196.201.217.48KPlandoncostello642@mailcatch.comKenyaEvidence
22-Oct-14 02:46117.26.249.209rc9yy1qy6celebratetkaymv@gmail.com
[ ce.l.ebr.at.e.tkaymv@gmail.com ]
China 
22-Oct-14 02:46193.150.120.82Michaelgapasczczxzvxvdsacsdsljljkjkljl@gmail.comRussian FederationEvidence
22-Oct-14 02:4614.110.176.182Muckrcxorelpayr@golfnewsonlinejp.comChinaEvidence
22-Oct-14 02:46117.26.249.209la8cl5cr7celebratetkaymv@gmail.com
[ ce.le.br.at.e.tkaymv@gmail.com ]
China 
22-Oct-14 02:46117.26.249.209ym4gr6ja8celebratetkaymv@gmail.com
[ c.e.le.b.rat.e.tkaymv@gmail.com ]
China 
22-Oct-14 02:46120.37.235.49rfxcvcgdhgvmjtransposemivnm@gmail.com
[ tran.s.pos.em.i.v.n.m@gmail.com ]
ChinaEvidence
22-Oct-14 02:4664.79.111.142silasedwardskowfxlifseypyyn@yahoo.comUnited States 
22-Oct-14 02:46120.43.30.98vhgdvbjplgagentrralpy@gmail.com
[ ag.ent.rr.a.lpy@gmail.com ]
ChinaEvidence
22-Oct-14 02:46188.165.251.205isotusawagxuwowocev@aspotgmail.orgFranceEvidence
22-Oct-14 02:46208.89.209.135jude11dyzkzqsuoxxxlifseypyyn@yahoo.comUnited States 
22-Oct-14 02:46110.89.27.29ljdedseyrojifappointjmxwno@gmail.com
[ ap.poi.n.t.jmx.wn.o@gmail.com ]
ChinaEvidence
22-Oct-14 02:46218.207.102.106CharlesBurolinjunfang@outlook.comChina 
22-Oct-14 02:46173.234.164.9CUqejxwilmer@hotmail.comUnited States 
22-Oct-14 02:46178.45.83.189AshBrielsleonid340i@gmail.comRussian FederationEvidence
22-Oct-14 02:46120.37.235.117fsdsfsrxzmdebtorkotets@gmail.com
[ d.ebt.o.rko.te.t.s@gmail.com ]
China 
22-Oct-14 02:46140.237.39.198pacdffgsvdrazuinstructqfho@gmail.com
[ i.n.s.tr.u.ctqfho@gmail.com ]
China 
22-Oct-14 02:46199.15.233.167Janiceeaxbeyourselffor@gmail.comUnited States 
22-Oct-14 02:4627.159.211.116wlgndguomodestlyfettlk@gmail.com
[ m.ode.st.l.y.fettl.k@gmail.com ]
ChinaEvidence
22-Oct-14 02:4627.19.148.87dlmvjastchutafre04@gugoumail.comChina 
22-Oct-14 02:46222.77.218.86rfxcvcgdhgxxsbuckskinjfjhf@gmail.com
[ bucksk.inj.fj.hf@gmail.com ]
ChinaEvidence
22-Oct-14 02:46104.128.29.136BOxenhambethanyoxenham@video.adriaticmail.com 
22-Oct-14 02:4694.23.251.168ocixemukuyisol@mailretor.comFranceEvidence
22-Oct-14 02:46104.128.29.136BOxenhambethanyoxenham@video.adriaticmail.com 
22-Oct-14 02:46218.75.155.242Terrie76Epeekmbfcr@hotmail.comChina 
22-Oct-14 02:46120.37.238.228pacdffgsvdrxjipurplehcjh@gmail.com
[ p.u.rple.hcj.h@gmail.com ]
China 
22-Oct-14 02:4627.153.229.244pacdffgsvdrmuzrawhidetfhe@gmail.com
[ ra.w.hid.e.t.f.he@gmail.com ]
ChinaEvidence
22-Oct-14 02:4627.153.207.29replica Louis Vuitton M41524fhgfhghgfhg@gmail.comChina 
22-Oct-14 02:4660.55.42.166CharlesBurolinjunfang@outlook.comChina 
22-Oct-14 02:4627.159.213.144ikjgdgsfgdwsqsegmentvvmihv@gmail.com
[ s.e.g.m.e.n.tvv.m.ih.v@gmail.com ]
ChinaEvidence
22-Oct-14 02:4614.110.176.182doprhuaperenfg@golfnewsonlinejp.comChinaEvidence
22-Oct-14 02:46120.43.25.88pacdffgsvdrqlsconsumerkzybzs@gmail.com
[ cons.um.er.kzy.bzs@gmail.com ]
ChinaEvidence
22-Oct-14 02:4627.159.202.59ljdedseyroukkcontendergizp@gmail.com
[ c.o.nt.en.derg.iz.p@gmail.com ]
ChinaEvidence
22-Oct-14 02:46199.15.233.167Ameliafbxbeyourselffor@gmail.comUnited States 
22-Oct-14 02:46110.89.53.94ljdedseyrotszreleasevdqr@gmail.com
[ r.e.l.eas.evd.q.r@gmail.com ]
ChinaEvidence
22-Oct-14 02:46120.43.28.74hauebdoyudererahmiths19608@gmail.com
[ d.er.er.a.h.miths19608@gmail.com ]
ChinaEvidence
22-Oct-14 02:46204.44.82.82mohamedturnbulljackqueline26malsam@yahoo.comUnited States 
22-Oct-14 02:4691.200.12.95Samuelplasexy521@gmail.com
[ a.s.ex.y5.2.1@gmail.com ]
UkraineEvidence
22-Oct-14 02:46140.237.36.198ljdwefdsyrofzieternaltnas@gmail.com
[ et.e.rna.ltn.as@gmail.com ]
ChinaEvidence
22-Oct-14 02:46195.211.155.138Darrenoapromotekthix@gmail.com
[ p.ro.motek.th.i.x@gmail.com ]
Ukraine 
22-Oct-14 02:4627.153.229.244ljdwefdsyrodwgrawhidetfhe@gmail.com
[ r.awhi.d.et.fh.e@gmail.com ]
ChinaEvidence
22-Oct-14 02:4637.59.32.148Mishelgoodsam@gmail.comFranceEvidence
22-Oct-14 02:4614.110.176.182rugtvvgollalpb@newsinhouse.comChina 
22-Oct-14 02:4637.59.32.148Aubreybonser@gmail.comFranceEvidence
22-Oct-14 02:46222.77.218.86ffcxsdhddcqbuckskinjfjhf@gmail.com
[ b.u.c.k.sk.injfjh.f@gmail.com ]
ChinaEvidence
22-Oct-14 02:46140.237.36.198ljdwefdsyrokyleternaltnas@gmail.com
[ eter.n.altn.as@gmail.com ]
ChinaEvidence
22-Oct-14 02:4627.159.202.59ljdedseyrouipcontendergizp@gmail.com
[ con.t.en.d.e.rgi.z.p@gmail.com ]
ChinaEvidence
22-Oct-14 02:46162.244.14.159OdetteLuceytce@fastdeal.com.br 
22-Oct-14 02:46117.26.249.65ErITPspbcDwhereasryktgt@gmail.com
[ w.her.eas.r.yktgt@gmail.com ]
ChinaEvidence
22-Oct-14 02:4637.59.32.148Isaacthebest@hotmail.comFranceEvidence
22-Oct-14 02:46120.43.30.179ljdedseyroqyhtabulaterzom@gmail.com
[ tabul.at.er.zo.m@gmail.com ]
ChinaEvidence
22-Oct-14 02:4637.59.32.148Briannajohn@hotmail.comFranceEvidence
22-Oct-14 02:4614.110.176.182Eroveccrclolikpq@newsinhouse.comChina 
22-Oct-14 02:4614.110.176.182lublnumootkso@newsinhouse.comChina 
22-Oct-14 02:4637.59.32.148Aubreyrazer22@yahoo.comFranceEvidence
22-Oct-14 02:4569.64.48.210BCollicotkyragnughkzy@outlook.comUnited States 
22-Oct-14 02:45121.205.239.23cheap louis vuitton replicas handbagsdfxzjkvhjkhjkhj@gmail.comChina 
22-Oct-14 02:45222.79.79.59Bxgpxyehedweaponrynupl@gmail.com
[ we.apo.n.r.yn.upl@gmail.com ]
China 
22-Oct-14 02:455.39.26.94DUchancehouse@trash-mail.comFrance 
22-Oct-14 02:45140.237.39.198pacdffgsvdregeinstructqfho@gmail.com
[ ins.t.ru.ct.q.fh.o@gmail.com ]
China 
22-Oct-14 02:45110.85.102.4lmngdcvwyvportioniluoig@gmail.com
[ po.r.t.i.o.n.il.u.oig@gmail.com ]
China 
22-Oct-14 02:45140.237.39.198ljdwefdsyroophinstructqfho@gmail.com
[ inst.ru.ctqfh.o@gmail.com ]
China 
22-Oct-14 02:45140.237.36.198ljdwefdsyrouaheternaltnas@gmail.com
[ e.t.er.na.l.t.na.s@gmail.com ]
China 
22-Oct-14 02:4527.150.211.191tuk4qhu1qspawnkqwqms@gmail.com
[ s.p.aw.nk.q.w.qms@gmail.com ]
China 
22-Oct-14 02:4527.159.232.134k93u92xsassumptionzlul@gmail.com
[ a.s.sumpt.ionzlul@gmail.com ]
ChinaEvidence
22-Oct-14 02:45117.169.1.174ferminmerrimanxetoniamassola1212@trash-mail.comChina 
22-Oct-14 02:45107.155.187.12HiramParteeyettaeudadfn@outlook.com 
22-Oct-14 02:4582.102.24.33Lesterleldstehly124cuc@hotmail.comPortugal 
22-Oct-14 02:45120.37.235.28ljdedseyroonhdawningrobhcq@gmail.com
[ dawn.ing.r.o.b.h.cq@gmail.com ]
China 
22-Oct-14 02:45222.247.36.1879ynobgv908o3dadfwwwefee5566@gmail.com
[ d.a.dfww.we.fee5.56.6@gmail.com ]
ChinaEvidence
22-Oct-14 02:45107.190.160.52GroveCoronesalysiamensingwttc@yahoo.com 
22-Oct-14 02:45121.14.9.75jodylaurensijdzshbobiskerfr@yahoo.comChina 
22-Oct-14 02:4527.154.45.146cpmrlksyxngymnasticyiil@gmail.com
[ gymnasticyiil+ncxmwx@gmail.com ]
China 
22-Oct-14 02:4588.80.20.150AWhitwortjanniestrouse@mailcatch.comSweden 
22-Oct-14 02:45120.37.235.117yiyhngdjyyhwdebtorkotets@gmail.com
[ de.bt.o.rko.te.t.s@gmail.com ]
China 
22-Oct-14 02:4537.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
22-Oct-14 02:45188.240.138.118SElthamnywepylojev@hotmail.comRomania 
22-Oct-14 02:45199.15.233.187Helengdfbeyourselffor@gmail.comUnited States 
22-Oct-14 02:4562.210.114.49JCromwellsinkholeore@yahoo.comFrance 
22-Oct-14 02:4558.61.29.233DamionFarmavislnyoh@hotmail.comChina 
22-Oct-14 02:4546.0.57.167AshBrielsleonid340i@gmail.comRussian FederationEvidence
22-Oct-14 02:45142.4.215.59DwayneBermdwaynequiczt@hotchristianlouboutinsalefr.comCanada 
22-Oct-14 02:4591.200.12.53NpKQYvlvyKwhereasryktgt@gmail.com
[ whe.r.e.a.s.rykt.g.t@gmail.com ]
UkraineEvidence
22-Oct-14 02:4546.118.121.75Phyllisrinyphylis94zi@gmail.comUkraineEvidence
22-Oct-14 02:4527.159.211.116ffgjhggnriptmodestlyfettlk@gmail.com
[ m.o.de.s.tl.yf.e.ttlk@gmail.com ]
China 
22-Oct-14 02:45142.4.215.59MatthewKahmatthewptsk@newchristianlouboutinoutletfr.comCanada 
22-Oct-14 02:45120.37.235.49ffcxsdhdeimtransposemivnm@gmail.com
[ t.ran.sp.osemiv.n.m@gmail.com ]
China 
22-Oct-14 02:4593.118.75.47yong9252tpbxfamrzcdevonsummer53@yahoo.comRomania 
22-Oct-14 02:4527.153.231.47ljdwefdsyroaeqfeatureuhhv@gmail.com
[ fea.t.u.r.eu.h.hv@gmail.com ]
China 
22-Oct-14 02:4591.236.75.118MichaelHessmichaelbynciq@buymichaelkorsoutletca.caPoland 
22-Oct-14 02:45159.224.160.225enewmumiudexuqone@emailll.orgUkraineEvidence
22-Oct-14 02:4527.159.211.116fdddevfrkccmodestlyfettlk@gmail.com
[ mode.s.t.l.yf.e.tt.lk@gmail.com ]
China 
22-Oct-14 02:45120.43.30.98ldfcvhrfdofngagentrralpy@gmail.com
[ a.ge.ntrra.lp.y@gmail.com ]
China 
22-Oct-14 02:4437.57.231.219Howardenortega.sebastian@ufrbox.netUkraineEvidence
22-Oct-14 02:44173.44.61.152MRahmanmarciaoohgaw@outlook.comUnited States 
22-Oct-14 02:4427.153.230.217kffhfggdrdqacceleratetwxtpi@gmail.com
[ acc.e.lerate.tw.xt.pi@gmail.com ]
ChinaEvidence
22-Oct-14 02:4427.159.213.144fbfbvrewbsegmentvvmihv@gmail.com
[ s.egm.e.nt.v.vmi.hv@gmail.com ]
ChinaEvidence
22-Oct-14 02:44126.114.213.50lgwrhdhgalaomilaomi6978542@gmail.com
[ laomi.l.ao.mi6978542@gmail.com ]
Japan 
22-Oct-14 02:44194.165.30.126aaadvegeChepaaadvege@dv-ege.ruRussian Federation 
22-Oct-14 02:4414.110.176.182Deriagdnpoushqbl@newsinhouse.comChina 
22-Oct-14 02:4491.200.13.5Anellicowanellicow@host15.ruUkraineEvidence
22-Oct-14 02:44110.85.102.4ghfvhjorzwportioniluoig@gmail.com
[ port.ion.ilu.o.i.g@gmail.com ]
China 
22-Oct-14 02:4427.153.228.117pasyaervjqleisuredwra@gmail.com
[ leis.ur.e.dwra@gmail.com ]
ChinaEvidence
22-Oct-14 02:4491.200.13.5ArgiroVogargirovog@blog-1.ruUkraineEvidence
22-Oct-14 02:44182.118.23.7xvcwecmufoerzufxzczxczxczxcxc@outlook.comChina 
22-Oct-14 02:44110.85.103.238pacdffgsvdrcxuopponentdfiw@gmail.com
[ o.p.p.o.n.e.nt.dfiw@gmail.com ]
China 
22-Oct-14 02:44110.86.70.171derekhunt39debtorllzg@gmail.com
[ d.e.b.tor.llz.g@gmail.com ]
China 
22-Oct-14 02:4446.118.113.196eexifesuyekwahquwob@hotermail.orgUkraineEvidence
22-Oct-14 02:44120.37.234.206pndoarjlrsymbolgnayi@gmail.com
[ s.ym.bo.lgnay.i@gmail.com ]
ChinaEvidence
22-Oct-14 02:4482.102.24.33Charlesktschlensker699dana@hotmail.comPortugalEvidence
22-Oct-14 02:44188.165.204.64egiruqaikupajasahe@westmailer.comFranceEvidence
22-Oct-14 02:4427.159.213.144fbfbvrwbksegmentvvmihv@gmail.com
[ seg.m.ent.v.vmi.hv@gmail.com ]
ChinaEvidence
22-Oct-14 02:44110.89.53.94ljdedseyrotbkreleasevdqr@gmail.com
[ rel.ea.sevd.q.r@gmail.com ]
ChinaEvidence
22-Oct-14 02:44140.237.36.198ljdwefdsyroaqseternaltnas@gmail.com
[ ete.rn.altna.s@gmail.com ]
ChinaEvidence
22-Oct-14 02:4489.47.25.16whitneyf81yjlyccvmeridithriojas40@yahoo.comRomania 
22-Oct-14 02:44110.89.27.29ljdedseyrornxappointjmxwno@gmail.com
[ ap.p.o.i.n.tjmxwn.o@gmail.com ]
ChinaEvidence
22-Oct-14 02:4446.118.113.142eupagumixeqijiizir@yandexmailserv.comUkraineEvidence
22-Oct-14 02:4427.159.213.144ikjgdgsfgdhwzsegmentvvmihv@gmail.com
[ se.gment.vvmih.v@gmail.com ]
ChinaEvidence
22-Oct-14 02:44140.237.39.195pacdffgsvdrzfirescueuilc@gmail.com
[ r.e.scu.e.u.i.l.c@gmail.com ]
ChinaEvidence
22-Oct-14 02:44183.207.228.3YNtrudy25493@outlook.comChina 
22-Oct-14 02:44193.201.224.59GeorgeSihilm126ps@h4.articletarget.comUkraine 
22-Oct-14 02:4491.207.7.182JosephZepmarie@thehosh.comUkraine 
22-Oct-14 02:44120.37.234.206pndoarobusymbolgnayi@gmail.com
[ sy.m.b.o.lgn.a.yi@gmail.com ]
ChinaEvidence
22-Oct-14 02:44120.37.208.160louis vuitton palermo gm toteytru@gmail.comChina 
22-Oct-14 02:44178.45.83.189AshBrielsleonid340i@gmail.comRussian FederationEvidence
22-Oct-14 02:44176.31.122.130kufezumocalakoxo@erermail.comFranceEvidence
22-Oct-14 02:4491.200.12.95Samuelfuroasexy521@gmail.com
[ a.sexy.52.1@gmail.com ]
UkraineEvidence
22-Oct-14 02:4493.118.69.109UKmehytafyzan@hotmail.comRomania 
22-Oct-14 02:4427.153.230.217lkhgfdqfxacceleratetwxtpi@gmail.com
[ ac.c.e.l.er.at.e.t.w.xtpi@gmail.com ]
ChinaEvidence
22-Oct-14 02:44183.207.228.3XOhistoricalruin560487@outlook.comChina 
22-Oct-14 02:4491.207.4.22xvcwecmufoerzufxzczxczxczxcxc@outlook.comUkraine 
22-Oct-14 02:44199.15.233.189Pv1tbytj2xbdcsctgb211@hotmail.comUnited States 
22-Oct-14 02:44199.15.233.169Evangelinexwbeyourselffor@gmail.comUnited States 
22-Oct-14 02:44175.42.95.252buig83j51gagasdf2303sjga3235ga@gmail.com
[ gaga.s.df230.3s.jga.3235ga@gmail.com ]
China 
22-Oct-14 02:44110.89.27.29pasyaeriuiappointjmxwno@gmail.com
[ appo.in.tjm.x.w.n.o@gmail.com ]
China 
22-Oct-14 02:44110.89.53.94ljdedseyroybrreleasevdqr@gmail.com
[ r.el.easevdqr@gmail.com ]
China 
22-Oct-14 02:44110.89.27.29ljdedseyrokfpappointjmxwno@gmail.com
[ appoin.t.jm.xw.no@gmail.com ]
China 
22-Oct-14 02:4427.153.249.27Fz0TZuswl6twhdkah3hfan@gmail.com
[ t.wh.dk.ah.3hf.an@gmail.com ]
China 
22-Oct-14 02:44222.77.225.133Louis Vuitton M41422 saleminh87juiads@gmail.comChina 
22-Oct-14 02:4427.154.11.145keynes447dubiousxhrr@gmail.com
[ du.bi.o.us.xhrr@gmail.com ]
ChinaEvidence
22-Oct-14 02:44193.150.120.82MichaelBymnasczczxzvxvdsacsdsljljkjkljl@gmail.comRussian FederationEvidence
22-Oct-14 02:44198.245.49.166SheldonDussheldonsuercr@pradaoutletus.usCanada 
22-Oct-14 02:44175.42.95.252buip67f91gagasdf2303sjga3235ga@gmail.com
[ gag.a.sd.f230.3s.jga.3235ga@gmail.com ]
China 
22-Oct-14 02:44117.26.248.6ljdedseyrowgucomedyolwh@gmail.com
[ co.me.d.y.o.lw.h@gmail.com ]
China 
22-Oct-14 02:44183.207.228.3GYdavepiqpfkxvq@outlook.comChina 
22-Oct-14 02:4437.57.200.173Touhaccotteabobydarky@ymail.orgUkraineEvidence
22-Oct-14 02:4446.118.121.75Phyllisrinyphylis94zi@gmail.comUkraineEvidence
22-Oct-14 02:44120.37.235.92kfgfdhdsvdbiologicalffknz@gmail.com
[ biolo.g.i.cal.f.f.kn.z@gmail.com ]
China 
22-Oct-14 02:44108.62.82.175CBaumcordagegram@hotmail.comUnited States 
22-Oct-14 02:4436.250.176.89hupnz71q19ebjerlg90eslfielylgs@gmail.com
[ e.b.j.e.rlg90e.s.lf.ielylgs@gmail.com ]
China 
22-Oct-14 02:44193.201.224.59GeorgeMaqdaf6926vk@h4.articletarget.comUkraine 
22-Oct-14 02:4436.250.176.89htatr4857webjerlg90eslfielylgs@gmail.com
[ e.b.je.r.lg90e.s.lf.ielylgs@gmail.com ]
China 
22-Oct-14 02:4427.159.232.134k93u92xsassumptionzlul@gmail.com
[ a.s.sumpt.ionzlul@gmail.com ]
ChinaEvidence
22-Oct-14 02:4436.250.176.89hupnq65n59ebjerlg90eslfielylgs@gmail.com
[ ebj.erlg.90e.s.lf.ielylgs@gmail.com ]
China 
22-Oct-14 02:4436.250.176.89htata5615lebjerlg90eslfielylgs@gmail.com
[ e.b.jer.l.g.90e.s.lf.ielylgs@gmail.com ]
China 
22-Oct-14 02:44110.89.63.94ntdyxvjvyhwuxingjurh181@126.comChinaEvidence
22-Oct-14 02:43110.86.68.27gerry788stoutixin@gmail.com
[ s.t.o.u.tix.i.n@gmail.com ]
China 
22-Oct-14 02:4331.184.238.72Robertdokelinastes7@seznam.czRussian FederationEvidence
22-Oct-14 02:43110.89.53.94pasyaerffrreleasevdqr@gmail.com
[ r.e.l.ea.se.vd.q.r@gmail.com ]
ChinaEvidence
22-Oct-14 02:4323.95.93.39ghlkerryzrtnsvfyctkatygambiniqeh@yahoo.comUnited States 
22-Oct-14 02:43117.30.35.121tyfirth61restrictroid@gmail.com
[ r.e.s.tr.i.c.t.roid@gmail.com ]
China 
22-Oct-14 02:4323.19.83.112danmatrawevovhsrzacliftonsteinmetz@discardmail.comUnited States 
22-Oct-14 02:43120.37.234.9rfxcvcgdhgcynsewagequzda@gmail.com
[ s.ewa.g.e.qu.zd.a@gmail.com ]
ChinaEvidence
22-Oct-14 02:43120.37.238.67pasyaertrlcampaigncomp@gmail.com
[ ca.m.pai.g.ncom.p@gmail.com ]
China 
22-Oct-14 02:4327.153.230.217frhhhdrlatacceleratetwxtpi@gmail.com
[ acce.l.era.te.twxt.pi@gmail.com ]
ChinaEvidence
22-Oct-14 02:4391.200.12.84Etedeapemwedsguelphugo@gmail.comUkraine 
22-Oct-14 02:43199.15.233.187Donnauqbeyourselffor@gmail.comUnited States 
22-Oct-14 02:4359.58.157.219nike air max 1 gs billigxfhfghgjhjjh@gmail.comChina 
22-Oct-14 02:43120.37.238.228ljdwefdsyrocospurplehcjh@gmail.com
[ p.ur.p.lehcjh@gmail.com ]
ChinaEvidence
22-Oct-14 02:43117.169.1.31bbradashuley7275sunny@vijayanchor.comChina 
22-Oct-14 02:43173.208.193.82reinauebersaxnbaavinamfx@live.comUnited States 
22-Oct-14 02:4346.105.122.57demayimavutrgiw@erreemail.comFranceEvidence
22-Oct-14 02:4327.18.72.16BernardKipxiyangyang1124@hotmail.comChinaEvidence
22-Oct-14 02:4314.110.176.182Agivagifsouseow@blogshoponline.comChinaEvidence
22-Oct-14 02:4327.153.161.137cheap Air Jordan 5 Cement Grey shoesdsgesnb@gmail.comChina 
22-Oct-14 02:43110.89.27.29ljdedseyroannappointjmxwno@gmail.com
[ app.o.int.j.m.xw.no@gmail.com ]
ChinaEvidence
22-Oct-14 02:43120.37.235.154fdsgdhdhvsghosttcrqu@gmail.com
[ g.hos.ttcrqu@gmail.com ]
ChinaEvidence
22-Oct-14 02:43120.43.30.98fnbhhfcrkjcagentrralpy@gmail.com
[ age.n.t.rra.lp.y@gmail.com ]
China 
22-Oct-14 02:43223.240.139.231Cabyfeedberlh3438916@hotmail.comChinaEvidence
22-Oct-14 02:43110.89.61.24028aenvompidealrdsfwfqks@gmail.com
[ ideal.r.dsf.w.f.qk.s@gmail.com ]
ChinaEvidence
22-Oct-14 02:43110.89.53.195ffcxsdhdawhsewagequzda@gmail.com
[ s.ewage.qu.zd.a@gmail.com ]
ChinaEvidence
22-Oct-14 02:43120.37.235.92ffcxsdhdelxbiologicalffknz@gmail.com
[ bi.ol.o.gic.al.ffkn.z@gmail.com ]
ChinaEvidence
22-Oct-14 02:4346.0.57.167AshBrielsleonid340i@gmail.comRussian FederationEvidence
22-Oct-14 02:43125.86.25.162Gonssaquibmhl@tokkabanshop.comChinaEvidence
22-Oct-14 02:4380.72.35.84FYzegarelli46708@acne.co.plPoland 
22-Oct-14 02:43120.37.235.28ljdedseyrokizdawningrobhcq@gmail.com
[ da.wn.i.ngro.b.h.c.q@gmail.com ]
ChinaEvidence
22-Oct-14 02:43223.240.139.231accinkfoovalh3438916@hotmail.comChinaEvidence
22-Oct-14 02:43113.245.119.146ri4kufzmxi2nqy7@sina.comChinaEvidence
22-Oct-14 02:43125.78.218.35louis vuitton monogram neverfull mm baghuygyug@gmail.comChina 
22-Oct-14 02:43120.43.4.197Louis Vuitton M40582 replicadrfgrh@gmail.comChina 
22-Oct-14 02:4327.153.229.244pacdffgsvdrbjdrawhidetfhe@gmail.com
[ rawhid.etf.he@gmail.com ]
ChinaEvidence
22-Oct-14 02:43222.77.218.86kfgfdhdvxubuckskinjfjhf@gmail.com
[ b.u.c.k.s.kinjfjh.f@gmail.com ]
China 
22-Oct-14 02:4394.23.3.143ioneleekayezisioifl@gmail.comFranceEvidence
22-Oct-14 02:43113.245.109.22ka7lqtdwzz9xos8@sina.comChinaEvidence
22-Oct-14 02:43110.89.53.195rfxcvcgdhgosfsewagequzda@gmail.com
[ sew.ag.e.quz.da@gmail.com ]
ChinaEvidence
22-Oct-14 02:4359.58.156.190louis vuitton passy gm discontinueddzfzsgfdgzdfg@gmail.comChina 
22-Oct-14 02:4337.59.56.42ozajogaawecasaa@asddddmail.orgFranceEvidence
22-Oct-14 02:4314.110.176.182meskcalsottasi@janewsonline.comChinaEvidence
22-Oct-14 02:4327.153.229.70arreseduthallmarkhpxk@gmail.com
[ h.a.llm.a.r.kh.p.xk@gmail.com ]
ChinaEvidence
22-Oct-14 02:43120.33.217.42pasyaerkqalongtermuaklbw@gmail.com
[ lo.ng.t.e.rm.u.ak.lb.w@gmail.com ]
China 
22-Oct-14 02:43192.151.156.226taiervensk5mccomaspn@live.comUnited States 
22-Oct-14 02:4327.159.202.59ljdedseyrogfxcontendergizp@gmail.com
[ c.onte.nde.r.gi.zp@gmail.com ]
China 
22-Oct-14 02:43125.86.25.162Hokgappeo@gmail.comChinaEvidence
22-Oct-14 02:43110.89.62.248beqdlzbmtfianboxiangej918@126.comChina 
22-Oct-14 02:4327.153.231.47pacdffgsvdrzlafeatureuhhv@gmail.com
[ fe.at.ureu.h.h.v@gmail.com ]
China 
22-Oct-14 02:43222.77.218.86kfgfdhdxezbuckskinjfjhf@gmail.com
[ b.uc.k.s.ki.n.jfjhf@gmail.com ]
China 
22-Oct-14 02:43110.89.62.113bangelspitty5660qifengpingfh499@126.comChina 
22-Oct-14 02:43176.31.122.130ocimuhoujucucayin@domeerer.comFranceEvidence
22-Oct-14 02:4394.23.3.143wopiyaziqixaxawoi@gmail.comFranceEvidence
22-Oct-14 02:43110.89.62.113annatpetovy101qifengpingfh499@126.comChina 
22-Oct-14 02:4327.153.228.117ljdedseyrokhxleisuredwra@gmail.com
[ leisure.d.wr.a@gmail.com ]
ChinaEvidence
22-Oct-14 02:4314.110.176.182kentphrabexm@newsinhouse.comChina 
22-Oct-14 02:4314.110.176.182ItaGepaqtaxlbo@newsinhouse.comChina 
22-Oct-14 02:4392.43.188.192AndrewkatZLazyyb1@mail.ruRussian Federation 
Legend
toxic Toxic IP address or "bad" email domain
Highlighted Hot IP or disposable email address